Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072570
Gene name
Locationscaffold_04:1646538..1648965
Strand-
Gene length (bp)2427
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01251 Ribosomal_S7e Ribosomal protein S7e 1.4E-82 36 213
PF00071 Ras Ras family 6.0E-42 261 388
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.1E-32 261 376
PF00025 Arf ADP-ribosylation factor family 1.3E-10 260 383
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.3E-05 261 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10101|RS7_SCHPO 40S ribosomal protein S7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps7 PE=1 SV=2 24 217 2.0E-77
sp|P48164|RS7B_YEAST 40S ribosomal protein S7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7B PE=1 SV=1 25 214 7.0E-74
sp|P26786|RS7A_YEAST 40S ribosomal protein S7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7A PE=1 SV=4 34 214 9.0E-74
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 28 219 2.0E-72
sp|P02362|RS7_XENLA 40S ribosomal protein S7 OS=Xenopus laevis GN=rps7 PE=2 SV=2 41 214 6.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10101|RS7_SCHPO 40S ribosomal protein S7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps7 PE=1 SV=2 24 217 2.0E-77
sp|P48164|RS7B_YEAST 40S ribosomal protein S7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7B PE=1 SV=1 25 214 7.0E-74
sp|P26786|RS7A_YEAST 40S ribosomal protein S7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7A PE=1 SV=4 34 214 9.0E-74
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 28 219 2.0E-72
sp|P02362|RS7_XENLA 40S ribosomal protein S7 OS=Xenopus laevis GN=rps7 PE=2 SV=2 41 214 6.0E-70
sp|Q90YR7|RS7_ICTPU 40S ribosomal protein S7 OS=Ictalurus punctatus GN=rps7 PE=2 SV=1 32 214 8.0E-70
sp|P62083|RS7_RAT 40S ribosomal protein S7 OS=Rattus norvegicus GN=Rps7 PE=1 SV=1 41 214 1.0E-69
sp|P62082|RS7_MOUSE 40S ribosomal protein S7 OS=Mus musculus GN=Rps7 PE=2 SV=1 41 214 1.0E-69
sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens GN=RPS7 PE=1 SV=1 41 214 1.0E-69
sp|Q5RT64|RS7_FELCA 40S ribosomal protein S7 OS=Felis catus GN=RPS7 PE=2 SV=1 41 214 1.0E-69
sp|A6H769|RS7_BOVIN 40S ribosomal protein S7 OS=Bos taurus GN=RPS7 PE=2 SV=1 41 214 1.0E-69
sp|P62084|RS7_DANRE 40S ribosomal protein S7 OS=Danio rerio GN=rps7 PE=2 SV=1 41 214 2.0E-69
sp|P50894|RS7_TAKRU 40S ribosomal protein S7 OS=Takifugu rubripes GN=rps7 PE=3 SV=1 41 214 5.0E-69
sp|Q962S0|RS7_SPOFR 40S ribosomal protein S7 OS=Spodoptera frugiperda GN=RpS7 PE=2 SV=1 32 214 1.0E-62
sp|Q9VA91|RS7_DROME 40S ribosomal protein S7 OS=Drosophila melanogaster GN=RpS7 PE=1 SV=1 24 214 3.0E-62
sp|P48155|RS7_MANSE 40S ribosomal protein S7 OS=Manduca sexta GN=RpS7 PE=2 SV=1 26 214 7.0E-62
sp|P62085|RS7_DROYA 40S ribosomal protein S7 OS=Drosophila yakuba GN=RpS7 PE=2 SV=1 24 214 1.0E-61
sp|P33514|RS7_ANOGA 40S ribosomal protein S7 OS=Anopheles gambiae GN=RpS7 PE=2 SV=2 24 214 6.0E-61
sp|Q9NB21|RS7_CULQU 40S ribosomal protein S7 OS=Culex quinquefasciatus GN=RpS7 PE=2 SV=1 24 214 6.0E-60
sp|Q8LD03|RS73_ARATH 40S ribosomal protein S7-3 OS=Arabidopsis thaliana GN=RPS7C PE=1 SV=2 25 215 3.0E-57
sp|Q9M885|RS72_ARATH 40S ribosomal protein S7-2 OS=Arabidopsis thaliana GN=RPS7B PE=2 SV=1 41 216 3.0E-57
sp|Q9C514|RS71_ARATH 40S ribosomal protein S7-1 OS=Arabidopsis thaliana GN=RPS7A PE=2 SV=1 24 215 5.0E-57
sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 OS=Avicennia marina GN=RPS7 PE=2 SV=1 39 215 6.0E-56
sp|Q9XH45|RS7_BRAOL 40S ribosomal protein S7 OS=Brassica oleracea GN=RPS7 PE=2 SV=1 24 215 2.0E-55
sp|Q8LJU5|RS7_ORYSJ 40S ribosomal protein S7 OS=Oryza sativa subsp. japonica GN=RPS7 PE=2 SV=2 41 215 5.0E-55
sp|Q54I41|RS7_DICDI 40S ribosomal protein S7 OS=Dictyostelium discoideum GN=rps7 PE=1 SV=1 26 213 9.0E-55
sp|Q9XET4|RS7_SECCE 40S ribosomal protein S7 OS=Secale cereale GN=RPS7 PE=2 SV=1 41 215 3.0E-54
sp|Q23312|RS7_CAEEL 40S ribosomal protein S7 OS=Caenorhabditis elegans GN=rps-7 PE=3 SV=1 26 214 5.0E-53
sp|Q949H0|RS7_HORVU 40S ribosomal protein S7 OS=Hordeum vulgare GN=RPS7 PE=2 SV=1 41 215 2.0E-51
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 258 377 4.0E-37
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 252 389 4.0E-36
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 258 390 9.0E-36
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 256 390 2.0E-35
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 261 386 1.0E-34
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 261 389 1.0E-34
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 261 389 1.0E-34
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 261 389 1.0E-34
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 261 389 1.0E-34
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 261 389 1.0E-34
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 261 389 1.0E-34
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 261 389 1.0E-34
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 261 389 1.0E-34
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 261 389 2.0E-34
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 261 389 2.0E-34
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 253 390 2.0E-34
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 253 386 2.0E-34
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 254 383 3.0E-34
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 255 389 5.0E-34
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 253 389 6.0E-34
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 261 384 6.0E-34
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 230 389 7.0E-34
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 254 389 9.0E-34
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 254 389 9.0E-34
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 261 384 1.0E-33
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 248 389 1.0E-33
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 248 389 1.0E-33
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 248 389 1.0E-33
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 261 384 1.0E-33
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 253 386 1.0E-33
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 261 389 1.0E-33
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 261 384 1.0E-33
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 250 379 1.0E-33
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 255 390 1.0E-33
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 261 389 1.0E-33
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 261 389 1.0E-33
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 261 389 2.0E-33
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 261 389 2.0E-33
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 261 389 2.0E-33
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 246 386 2.0E-33
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 261 384 2.0E-33
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 254 389 2.0E-33
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 261 383 2.0E-33
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 261 383 2.0E-33
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 261 386 3.0E-33
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 261 389 4.0E-33
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 255 389 5.0E-33
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 261 389 5.0E-33
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 261 389 6.0E-33
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 261 383 6.0E-33
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 261 386 7.0E-33
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 261 384 1.0E-32
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 261 383 1.0E-32
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 261 386 2.0E-32
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 261 383 2.0E-32
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 261 389 2.0E-32
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 261 383 2.0E-32
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 261 383 2.0E-32
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 244 386 2.0E-32
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 246 386 3.0E-32
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 261 394 3.0E-32
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 261 388 4.0E-32
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 261 388 4.0E-32
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 261 388 4.0E-32
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 261 379 4.0E-32
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 253 384 5.0E-32
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 261 384 6.0E-32
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 261 383 7.0E-32
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 254 376 9.0E-32
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 261 383 1.0E-31
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 261 386 3.0E-31
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 261 386 4.0E-31
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 254 389 6.0E-31
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 254 389 6.0E-31
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 254 389 6.0E-31
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 254 389 6.0E-31
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 261 383 7.0E-31
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 254 389 7.0E-31
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 254 389 7.0E-31
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 244 386 7.0E-31
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 238 430 1.0E-30
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 255 394 2.0E-30
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 261 388 2.0E-30
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 251 389 3.0E-30
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 261 383 3.0E-30
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 261 383 5.0E-30
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 261 385 5.0E-30
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 254 386 7.0E-30
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 254 386 7.0E-30
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 254 386 7.0E-30
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 254 386 8.0E-30
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 261 386 9.0E-30
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 254 386 9.0E-30
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 246 382 1.0E-29
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 254 384 1.0E-29
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 261 386 1.0E-29
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 261 384 1.0E-29
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 255 394 1.0E-29
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 261 386 2.0E-29
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 261 377 2.0E-29
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 250 413 2.0E-29
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 258 384 2.0E-29
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 261 384 2.0E-29
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 261 383 2.0E-29
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 253 377 3.0E-29
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 261 383 3.0E-29
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 255 394 3.0E-29
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 261 383 3.0E-29
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 261 386 3.0E-29
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 261 384 3.0E-29
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 261 384 3.0E-29
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 261 383 3.0E-29
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 261 384 3.0E-29
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 261 384 3.0E-29
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 261 383 4.0E-29
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 261 383 4.0E-29
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 261 380 4.0E-29
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 261 383 4.0E-29
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 255 394 4.0E-29
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 254 386 4.0E-29
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 261 386 4.0E-29
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 261 383 4.0E-29
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 261 383 4.0E-29
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 261 383 5.0E-29
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 254 386 5.0E-29
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 254 386 5.0E-29
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 261 383 5.0E-29
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 254 386 5.0E-29
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 254 386 5.0E-29
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 254 386 5.0E-29
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 254 386 6.0E-29
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 261 380 6.0E-29
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 261 380 8.0E-29
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 254 389 9.0E-29
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 254 386 1.0E-28
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 261 380 1.0E-28
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 261 380 1.0E-28
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 242 384 1.0E-28
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 261 380 1.0E-28
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 252 385 1.0E-28
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 261 383 1.0E-28
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 261 383 1.0E-28
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 261 386 1.0E-28
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 261 384 1.0E-28
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 261 380 2.0E-28
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 261 380 2.0E-28
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 254 389 2.0E-28
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 261 384 2.0E-28
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 261 383 2.0E-28
sp|Q99P74|RB27B_RAT Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 254 389 2.0E-28
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 261 385 2.0E-28
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 261 386 3.0E-28
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 250 383 3.0E-28
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 261 455 3.0E-28
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 261 386 3.0E-28
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 254 389 3.0E-28
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 261 386 3.0E-28
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 254 384 4.0E-28
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 254 388 4.0E-28
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 254 388 4.0E-28
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 254 388 4.0E-28
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 261 389 4.0E-28
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 261 377 4.0E-28
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 255 394 5.0E-28
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 254 383 5.0E-28
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 261 384 6.0E-28
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 261 384 6.0E-28
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 261 377 6.0E-28
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 261 384 6.0E-28
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 261 386 7.0E-28
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 261 384 8.0E-28
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 254 388 8.0E-28
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 261 386 9.0E-28
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 261 383 1.0E-27
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 235 389 1.0E-27
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 261 384 1.0E-27
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 254 388 2.0E-27
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 261 384 2.0E-27
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 254 388 2.0E-27
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 250 389 2.0E-27
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 261 384 2.0E-27
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 261 384 2.0E-27
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 261 384 2.0E-27
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 254 388 2.0E-27
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 261 380 2.0E-27
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 254 388 2.0E-27
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 261 391 2.0E-27
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 235 389 3.0E-27
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 261 386 3.0E-27
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 260 385 3.0E-27
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 261 384 4.0E-27
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 261 384 4.0E-27
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 235 388 4.0E-27
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 261 389 4.0E-27
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 261 389 4.0E-27
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 261 384 4.0E-27
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 261 384 4.0E-27
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 261 389 4.0E-27
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 246 377 4.0E-27
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 261 384 5.0E-27
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 261 388 5.0E-27
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 246 389 5.0E-27
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 261 389 5.0E-27
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 261 389 5.0E-27
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 261 389 5.0E-27
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 261 386 5.0E-27
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 261 389 5.0E-27
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 261 389 5.0E-27
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 261 389 5.0E-27
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 261 389 6.0E-27
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 261 386 6.0E-27
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 261 453 7.0E-27
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 261 385 7.0E-27
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 254 388 7.0E-27
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 261 384 7.0E-27
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 261 389 8.0E-27
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 261 383 8.0E-27
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 261 377 9.0E-27
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 261 384 1.0E-26
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 235 388 1.0E-26
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 261 383 1.0E-26
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 261 384 1.0E-26
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 261 384 1.0E-26
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 261 384 1.0E-26
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 261 380 1.0E-26
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 261 384 1.0E-26
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 254 388 1.0E-26
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 254 385 1.0E-26
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 250 389 2.0E-26
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 250 389 2.0E-26
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 250 389 2.0E-26
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 250 389 2.0E-26
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 250 389 2.0E-26
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 251 389 2.0E-26
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 261 384 2.0E-26
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 250 383 2.0E-26
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 250 389 2.0E-26
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 250 389 2.0E-26
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 261 384 2.0E-26
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 261 389 2.0E-26
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 250 389 3.0E-26
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 261 383 3.0E-26
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 250 389 3.0E-26
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 254 382 3.0E-26
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 250 389 3.0E-26
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 250 389 3.0E-26
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 250 389 3.0E-26
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 250 389 3.0E-26
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 261 384 3.0E-26
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 261 383 4.0E-26
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 261 389 4.0E-26
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 261 384 4.0E-26
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 254 382 4.0E-26
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 254 382 4.0E-26
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 250 389 5.0E-26
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 261 389 5.0E-26
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 261 389 5.0E-26
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 238 389 6.0E-26
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 261 383 6.0E-26
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 250 389 6.0E-26
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 261 389 8.0E-26
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 261 384 8.0E-26
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 261 390 8.0E-26
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 261 390 8.0E-26
sp|Q55FU9|RAB24_DICDI Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 258 377 8.0E-26
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 250 389 8.0E-26
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 261 390 9.0E-26
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 261 384 9.0E-26
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 261 383 1.0E-25
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 250 389 1.0E-25
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 261 383 1.0E-25
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 261 389 1.0E-25
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 250 389 1.0E-25
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 261 383 1.0E-25
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 261 389 1.0E-25
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 261 390 1.0E-25
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 250 389 1.0E-25
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 253 389 2.0E-25
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 261 383 2.0E-25
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 261 383 2.0E-25
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 261 383 2.0E-25
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 261 383 2.0E-25
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 250 389 2.0E-25
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 251 386 2.0E-25
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 261 383 2.0E-25
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 261 386 2.0E-25
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 238 389 2.0E-25
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 238 386 3.0E-25
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 261 381 3.0E-25
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 261 389 3.0E-25
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 261 377 3.0E-25
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 261 390 3.0E-25
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 261 384 3.0E-25
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 261 384 3.0E-25
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 261 384 3.0E-25
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 261 383 3.0E-25
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 250 389 4.0E-25
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 261 384 4.0E-25
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 261 383 5.0E-25
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 261 384 5.0E-25
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 254 382 5.0E-25
sp|P35290|RAB24_MOUSE Ras-related protein Rab-24 OS=Mus musculus GN=Rab24 PE=1 SV=2 258 375 6.0E-25
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 254 382 6.0E-25
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 261 386 6.0E-25
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 254 386 6.0E-25
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 260 377 7.0E-25
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 261 386 7.0E-25
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 250 389 7.0E-25
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 261 389 8.0E-25
sp|Q969Q5|RAB24_HUMAN Ras-related protein Rab-24 OS=Homo sapiens GN=RAB24 PE=1 SV=1 258 375 9.0E-25
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 254 389 9.0E-25
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 261 389 9.0E-25
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 254 389 9.0E-25
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 261 376 1.0E-24
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 266 386 1.0E-24
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 261 386 2.0E-24
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 261 386 2.0E-24
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 250 379 2.0E-24
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 254 389 2.0E-24
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 256 389 2.0E-24
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 261 377 2.0E-24
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 261 385 2.0E-24
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 261 383 2.0E-24
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 250 389 2.0E-24
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 261 389 2.0E-24
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 255 389 2.0E-24
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 262 389 2.0E-24
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 254 389 3.0E-24
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 260 377 3.0E-24
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 261 383 4.0E-24
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 261 383 4.0E-24
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 255 384 4.0E-24
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 261 383 4.0E-24
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 250 389 5.0E-24
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 261 377 5.0E-24
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 254 388 6.0E-24
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 261 383 7.0E-24
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 261 388 7.0E-24
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 261 389 7.0E-24
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 261 397 7.0E-24
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 260 377 1.0E-23
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 261 377 2.0E-23
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 261 364 2.0E-23
sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 261 377 2.0E-23
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 260 377 2.0E-23
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 260 377 2.0E-23
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 260 377 3.0E-23
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 261 364 7.0E-23
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 261 377 1.0E-22
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 261 364 1.0E-22
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 258 389 2.0E-22
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 258 402 2.0E-22
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 261 389 3.0E-22
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 261 389 3.0E-22
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 261 389 3.0E-22
sp|Q20365|RAB33_CAEEL Ras-related protein Rab-33 OS=Caenorhabditis elegans GN=rab-33 PE=2 SV=1 245 390 4.0E-22
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 261 389 5.0E-22
sp|Q9H0N0|RAB6C_HUMAN Ras-related protein Rab-6C OS=Homo sapiens GN=RAB6C PE=1 SV=2 261 384 6.0E-22
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 262 384 7.0E-22
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 261 389 8.0E-22
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 261 389 8.0E-22
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 261 377 8.0E-22
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 261 377 1.0E-21
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 261 389 1.0E-21
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 261 389 1.0E-21
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 261 384 1.0E-21
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 261 389 1.0E-21
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 261 386 2.0E-21
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 261 379 2.0E-21
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 261 358 2.0E-21
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 261 358 2.0E-21
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 261 377 2.0E-21
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 258 381 2.0E-21
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 251 389 3.0E-21
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 261 358 3.0E-21
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 261 358 3.0E-21
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 261 389 4.0E-21
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 261 377 6.0E-21
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 261 377 7.0E-21
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 261 377 2.0E-20
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 261 377 2.0E-20
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 261 364 3.0E-20
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 261 377 3.0E-20
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 245 389 1.0E-19
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 255 358 3.0E-19
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 255 358 3.0E-19
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 254 384 4.0E-19
sp|Q9UBK7|RBL2A_HUMAN Rab-like protein 2A OS=Homo sapiens GN=RABL2A PE=1 SV=1 253 396 7.0E-19
sp|Q9NX57|RAB20_HUMAN Ras-related protein Rab-20 OS=Homo sapiens GN=RAB20 PE=1 SV=1 259 377 1.0E-18
sp|Q9UNT1|RBL2B_HUMAN Rab-like protein 2B OS=Homo sapiens GN=RABL2B PE=2 SV=1 253 396 1.0E-18
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 261 386 3.0E-18
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 261 386 3.0E-18
sp|Q54FG4|RABP_DICDI Ras-related protein RabP OS=Dictyostelium discoideum GN=rabP PE=3 SV=2 258 385 3.0E-18
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 261 386 3.0E-18
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 261 386 4.0E-18
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 261 386 4.0E-18
sp|Q86JC8|RABH_DICDI Ras-related protein RabH OS=Dictyostelium discoideum GN=rabH PE=3 SV=1 258 380 4.0E-18
sp|Q55EF0|RABT2_DICDI Ras-related protein RabT2 OS=Dictyostelium discoideum GN=rabT2 PE=3 SV=1 261 377 5.0E-18
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 261 386 5.0E-18
sp|Q55EG6|RABT1_DICDI Ras-related protein RabT1 OS=Dictyostelium discoideum GN=rabT1 PE=3 SV=1 261 377 5.0E-18
sp|E9Q9D5|RBL2A_MOUSE Rab-like protein 2A OS=Mus musculus GN=Rabl2 PE=1 SV=1 253 376 6.0E-18
sp|Q54P07|RB32D_DICDI Ras-related protein Rab-32D OS=Dictyostelium discoideum GN=rab32D PE=3 SV=1 261 376 7.0E-18
sp|Q5R573|RBL2A_PONAB Rab-like protein 2A OS=Pongo abelii GN=RABL2A PE=2 SV=1 261 376 7.0E-18
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 261 391 7.0E-18
sp|Q8MXQ2|RB32C_DICDI Ras-related protein Rab-32C OS=Dictyostelium discoideum GN=rab32C PE=3 SV=2 257 354 9.0E-18
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 261 386 9.0E-18
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 261 382 1.0E-17
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 261 386 1.0E-17
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 261 386 1.0E-17
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 261 386 2.0E-17
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 261 354 2.0E-17
sp|P35295|RAB20_MOUSE Ras-related protein Rab-20 OS=Mus musculus GN=Rab20 PE=2 SV=2 259 381 2.0E-17
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 261 377 2.0E-17
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 261 386 3.0E-17
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 261 386 3.0E-17
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 261 382 3.0E-17
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 261 387 5.0E-17
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 261 386 5.0E-17
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 256 390 7.0E-17
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 261 386 8.0E-17
sp|Q99KL7|RAB28_MOUSE Ras-related protein Rab-28 OS=Mus musculus GN=Rab28 PE=1 SV=1 261 386 8.0E-17
sp|P51157|RAB28_HUMAN Ras-related protein Rab-28 OS=Homo sapiens GN=RAB28 PE=1 SV=2 261 383 9.0E-17
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 261 386 1.0E-16
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 261 386 1.0E-16
sp|Q54QR3|RB32A_DICDI Ras-related protein Rab-32A OS=Dictyostelium discoideum GN=rab32A PE=1 SV=1 251 358 2.0E-16
sp|Q5RFI2|RAB28_PONAB Ras-related protein Rab-28 OS=Pongo abelii GN=RAB28 PE=2 SV=1 261 383 2.0E-16
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 261 386 2.0E-16
sp|Q13637|RAB32_HUMAN Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3 261 358 2.0E-16
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 261 387 2.0E-16
sp|P51158|RAB28_RAT Ras-related protein Rab-28 OS=Rattus norvegicus GN=Rab28 PE=2 SV=1 261 386 2.0E-16
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 261 386 2.0E-16
sp|Q3SWY9|RAB28_BOVIN Ras-related protein Rab-28 OS=Bos taurus GN=RAB28 PE=2 SV=1 261 383 2.0E-16
sp|Q54FK5|RABN1_DICDI Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 261 377 3.0E-16
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 247 377 3.0E-16
sp|P57729|RAB38_HUMAN Ras-related protein Rab-38 OS=Homo sapiens GN=RAB38 PE=1 SV=1 261 358 3.0E-16
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 261 368 4.0E-16
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 261 390 4.0E-16
sp|Q8QZZ8|RAB38_MOUSE Ras-related protein Rab-38 OS=Mus musculus GN=Rab38 PE=1 SV=1 261 358 4.0E-16
sp|Q96S21|RB40C_HUMAN Ras-related protein Rab-40C OS=Homo sapiens GN=RAB40C PE=1 SV=1 254 389 4.0E-16
sp|Q8VHQ4|RB40C_MOUSE Ras-related protein Rab-40C OS=Mus musculus GN=Rab40c PE=1 SV=1 254 389 5.0E-16
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 261 387 5.0E-16
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 261 387 5.0E-16
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 261 387 5.0E-16
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 261 387 5.0E-16
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 261 387 5.0E-16
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 261 386 5.0E-16
sp|Q9EQT3|RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 261 390 6.0E-16
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 261 368 7.0E-16
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 261 368 8.0E-16
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 261 387 8.0E-16
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 261 391 8.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0005525 GTP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0043226 organelle No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0036094 small molecule binding No
GO:0009059 macromolecule biosynthetic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0017076 purine nucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0005198 structural molecule activity No
GO:0019001 guanyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043604 amide biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0043167 ion binding No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072570
MIPKKEVNSVSKFGLVVAWSLIKMSVNNKILRTANAPTSPPDEIEIAVAQALIDLENNVPELKNELRALQISAAR
EVDVRGGKKAIVVFVPVPQLNAFHKIQARLTRELEKKFSDRHVVFIAQRRMLRKPTRNSRVKQKRPRSRTLTNVH
EKILEDLVHPTEIVGKRTRVGVDGSKLLKVFLDSKDQTSLEYKLDSFSSVYRRLTGKEVVFEFPVVSQDEPGEPA
REMMDLKGKSGYGSACSPPAMDPYVHPRYDHGIDSKIVVMGNSGVGKTSLLHRYTQNRFDPKNTTSTSGAFFVTK
KVLVNGLKVRLQLWDTAGQERFRSMAPMYYRGANAALLLYDITNSSTFEDVRGWLQELRKNCSPELIIYIVGAKA
DLHHRRQVTSDLARLSLHNWFPPPKPPPPVPPPPPPSTLSYIRPRFTSFPGLRSHSAPSCSPVSPETPAYLDLPS
SRASALQRSKTTMQTRPRTANSLTRSNASSGSRTPQSSRFGSHFGFGGGWDAHGDNSSNSIEEEDEYAVDPESDE
GEWGLSKGMELFEVSAKDDVGIQGLFDHLISAIILRKDAIEQENEARKRDSVFLSNVCTPAWSAQADEEEARQKA
QQRSGSWSCC*
Coding >Agabi119p4|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGCCTGGTCCCTCATCAAGATGTCG
GTGAACAACAAAATCCTCCGCACAGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCTGTTGCCCAG
GCTCTCATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGT
GAAGTTGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAA
ATTCAGGCTAGGCTGACACGAGAATTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGA
ATGTTGCGCAAACCCACACGTAATTCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCAC
GAAAAGATCCTTGAGGATCTCGTCCACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGATGGTTCG
AAATTGCTGAAAGTGTTCCTTGACTCAAAAGACCAAACATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTG
TACCGCCGTCTGACAGGGAAGGAAGTTGTGTTTGAATTTCCGGTAGTGTCGCAGGACGAACCGGGCGAGCCAGCT
CGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGGACCCCTACGTC
CACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCAAAACCTCCCTC
CTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCTTCGTCACCAAG
AAAGTCCTGGTCAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGCCAGGAGCGTTTTCGCAGCATG
GCACCCATGTATTATCGAGGCGCAAACGCCGCTCTCCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGAC
GTCCGCGGCTGGCTGCAAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACATCGTTGGTGCCAAAGCT
GACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAATTGGTTTCCTCCACCCAAA
CCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCGCTTCACATCCTTCCCC
GGCCTTCGATCCCACTCTGCCCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTATCTTGACCTGCCCTCT
AGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGCAAACTCGCTTACGCGA
TCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGGCTTTGGAGGAGGCTGG
GACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGACCCGGAAAGCGACGAA
GGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGTTGGCATCCAAGGTCTC
TTTGACCACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGAT
AGTGTATTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCC
CAGCAACGCTCTGGCAGTTGGAGTTGCTGCTAG
Transcript >Agabi119p4|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGCCTGGTCCCTCATCAAGATGTCG
GTGAACAACAAAATCCTCCGCACAGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCTGTTGCCCAG
GCTCTCATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGT
GAAGTTGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAA
ATTCAGGCTAGGCTGACACGAGAATTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGA
ATGTTGCGCAAACCCACACGTAATTCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCAC
GAAAAGATCCTTGAGGATCTCGTCCACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGATGGTTCG
AAATTGCTGAAAGTGTTCCTTGACTCAAAAGACCAAACATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTG
TACCGCCGTCTGACAGGGAAGGAAGTTGTGTTTGAATTTCCGGTAGTGTCGCAGGACGAACCGGGCGAGCCAGCT
CGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGGACCCCTACGTC
CACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCAAAACCTCCCTC
CTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCTTCGTCACCAAG
AAAGTCCTGGTCAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGCCAGGAGCGTTTTCGCAGCATG
GCACCCATGTATTATCGAGGCGCAAACGCCGCTCTCCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGAC
GTCCGCGGCTGGCTGCAAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACATCGTTGGTGCCAAAGCT
GACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAATTGGTTTCCTCCACCCAAA
CCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCGCTTCACATCCTTCCCC
GGCCTTCGATCCCACTCTGCCCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTATCTTGACCTGCCCTCT
AGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGCAAACTCGCTTACGCGA
TCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGGCTTTGGAGGAGGCTGG
GACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGACCCGGAAAGCGACGAA
GGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGTTGGCATCCAAGGTCTC
TTTGACCACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGAT
AGTGTATTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCC
CAGCAACGCTCTGGCAGTTGGAGTTGCTGCTAG
Gene >Agabi119p4|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGTAAGCCAGCCCGTCTGCCTGGTC
ATCAAGAAACCTCTCATCAACGTCGTTGTCGTCGTCAAAAGGCCTGGTAAGTCCCAATTTATGCCCGTCTATGTT
GCGCGATCCAGTGAAGATGGTTCAATAATGCTGGCAAGGCGAGGAATGGAAGGGTTGAGATGGATGGCGCGTTTC
GAGTGTGGATGTGGGATCTTAAGCTGATAGTGCCTTCTCTGCGTATGCCAGGTCCCTCATCAAGATGTCGGTGAA
CAACAAAATCCTCCGCACAGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCTGTTGCCCAGGCTCT
CATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGTGAAGT
TGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAAATTCA
GGCTAGGTGGGTTTACGGCTGCTTAATTATGTCTATTATAGGATGATTGACCAGTGGAGCAGGCTGACACGAGAA
TTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGAATGTTGCGCAAACCCACACGTAAT
TCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCACGAAAAGATCCTTGAGGATCTCGTC
CACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGATGGTTCGAAATTGCTGAAAGTGTATGTGCCC
AATCTAGATACAGGGAAAAAGAGACGCTGACGGATTTATTGGGATTTGACAGGTTCCTTGACTCAAAAGACCAAA
CATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTGTACCGCCGTCTGACAGGGAAGGAAGTTGTGTTTGAAT
TTCCGGTAGTGTCGCAGGAGTAGATAGATAGCTGTAGCGAACATGGGATTTCTGACCTGGAGAAGCGAACCGGGC
GAGCCAGCTCGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGGAC
CCCTACGTCCACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCAAA
ACCTCCCTCCTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCTTC
GTCACCAAGAAAGTCCTGGTCAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGCCAGGAGCGTTTT
CGCAGCATGGTAATTTCCTCTCCCCTGCGCCCCCTTTTTACTTCTCACTAGTGTTGTCTAGGCACCCATGTATTA
TCGAGGTATCAGTTAGCCATTTGTCTCCCCCCCCCCCCCCCACTCACCCGCCCTTCCAGGCGCAAACGCCGCTCT
CCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGACGTCCGCGGCTGGCTGCAAGGTTTGTTCACTACACC
ATTCCACCTGTCAAACGCTCATTCCCCCTGCAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACATCG
TTGGTGCCAAAGCTGACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAATTGGT
TTCCTCCACCCAAACCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCGCT
TCACATCCTTCCCCGGCCTTCGATCCCACTCTGCCCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTATC
TTGACCTGCCCTCTAGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGCAA
ACTCGCTTACGCGATCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGGCT
TTGGAGGAGGCTGGGACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGACC
CGGAAAGCGACGAAGGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGTTG
GTACGTTTGCTTCAGGAACCAGCTGATCGACGCCCAGGCTGACGATTGTCTTTAGGCATCCAAGGTCTCTTTGAC
CACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGATAGTGTA
TTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCCCAGCAA
CGCTCTGGCAGTTGGAGTTGCTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail