Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072340
Gene name
Locationscaffold_04:1592927..1593414
Strand-
Gene length (bp)487
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08520 DUF1748 Fungal protein of unknown function (DUF1748) 2.5E-27 2 70

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2V2P4|YI156_YEAST Uncharacterized protein YIL156W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL156W-B PE=3 SV=1 1 71 3.0E-20
sp|Q10167|YAUE_SCHPO Uncharacterized protein C26A3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26A3.14c PE=4 SV=1 4 70 5.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072340
MFGKLVHIGFDAVLISAFLAGLKRTTGLTPTLAQVPNKDIRQFLRSYLEFGEYIFDFTVVIFGRSPFFERQR*
Coding >Agabi119p4|072340
ATGTTTGGGAAACTGGTACACATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACA
ACTGGCCTCACACCCACTCTGGCCCAAGTCCCTAACAAGGACATCCGTCAATTTCTGCGCAGCTACCTCGAATTC
GGCGAATACATCTTCGACTTTACGGTTGTTATCTTCGGCCGTTCACCCTTCTTCGAGAGACAGCGATGA
Transcript >Agabi119p4|072340
ATGTTTGGGAAACTGGTACACATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACA
ACTGGCCTCACACCCACTCTGGCCCAAGTCCCTAACAAGGACATCCGTCAATTTCTGCGCAGCTACCTCGAATTC
GGCGAATACATCTTCGACTTTACGGTTGTTATCTTCGGCCGTTCACCCTTCTTCGAGAGACAGCGATGA
Gene >Agabi119p4|072340
ATGTTTGGGAAACTGGGTTCGACCGCTCTCTCCCTTGGTGGGATCTACCTGCTCACTCGCGCCTCTCTAGTACAC
ATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACAACTGGCCTCACGTACGTATAC
GCATCTCGCAGCTCAATCTGTCGACTCACACCATGATTCAGACCCACTCTGGCCCAAGTCCCTAACAAGGACATC
CGTCGTACGCGACCTGTATCTATCATTCTGACTTCTCACCCACGAATTATGTTTCAGAATTTCTGCGCAGCTACC
TCGAATTCGGTCTGTTGTTTCTACCGTCGACTTTGCTTGCCATTCCCTCGTTCTCATTCTTACGTGTAGGCGAAT
ACATCTTCGACTTTACGGTTGTTATCTTCGGCGTACGTCCATTCGTGTGGCTCATGCTACTCGCAAACTCACGTC
ACCCCAGCGTTCACCCTTCTTCGAGAGACAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail