Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071830
Gene name
Locationscaffold_04:1489466..1492448
Strand+
Gene length (bp)2982
Transcript length (bp)2562
Coding sequence length (bp)2562
Protein length (aa) 854

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10168 Nup88 Nuclear pore component 1.1E-12 91 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P382|NUP82_SCHPO Nucleoporin nup82 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup82 PE=3 SV=1 72 761 6.0E-30
sp|G0S4F3|NUP82_CHATD Nucleoporin NUP82 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP82 PE=1 SV=1 60 761 2.0E-27
sp|Q9FFK6|NUP88_ARATH Nuclear pore complex protein NUP88 OS=Arabidopsis thaliana GN=NUP88 PE=1 SV=1 106 263 9.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071830
MLLNPANEWNEALSEHPIFSLPKAFDGPLADARDSLELSTNTLPRFVKVDLLDDGPAPSGRRQTVILKDADLIVA
AGREIRMTTLGDAKGGQSTRKTYKALHTPNVQFTIHQISLNPNGKLLAVAGAFQVAVIVLPRPGLTRLVPETIDC
KSVQVGQFYHASKNSAPIAKIEWHPWGEAASTLLVMTTDGKLREYDISVDTEEPQQVLSFVPERKSKSYLAEDAS
EREVASFALGKGRADWGPLTVYALMKSGDIYAICPYLPTNASVPSSYIHSLECFISAKQEFLSQDASRASPTLNA
IYDYQQKYVSALLRELPSGIVFPATSRVVSLHPPTNIKSPPTRQGPFLLQPEPRALEGSDGGDATDIAYLVFGTE
SDDDDNSEREGNPTEHLGIITVAYQDGKVDLYLDVEKVEARWDATHELIRDLPMLAVYETIDLGIFSTINSIADS
CLDLLQANHPVLLPDPIYDDIVYVYHAFGVHALHIGPVLQHLGIALRGADDETALTEALQNPVETHVQPLLTTFS
VEQRSSNPIIGVTLPNDVYLSYSILILTSAMRISVFPLTLRSETVHESNAEAASAILTGTAPPEKSKWLTPVEGL
PPPFVSPLARDPFEIPPIFSGNSLPSVPRHSLPASVTSKEILLTPDVLMYLLRATEHLSSQVRDINFAYSAVKFR
NQLQEKELELHVKVAGILNQKIEKLKGERKSAMDARIEKLHTTQKELLVRLDQLLAALMREASPELSEHEVKWFE
ELKRMKLEVLGSGKYDADSLAAKTKQLENEYARITPALKAVLEKEKLRKDKLAEVNGSLGFSQAFNFGQQSTAEQ
TKIHKLEKSVSKLAAQLNITLGKMPHSE*
Coding >Agabi119p4|071830
ATGTTGCTCAACCCCGCAAACGAGTGGAACGAAGCTCTCAGCGAACATCCCATCTTTTCCCTCCCAAAGGCCTTC
GACGGGCCTCTCGCAGACGCACGGGACTCCCTCGAACTTTCTACAAACACCCTCCCCCGCTTCGTCAAGGTCGAT
CTCCTGGACGATGGACCGGCTCCCTCAGGACGGAGGCAGACTGTGATCCTCAAAGATGCGGACCTCATTGTGGCT
GCTGGAAGAGAAATTCGGATGACGACCCTGGGAGATGCAAAAGGTGGTCAAAGTACGCGAAAGACATACAAGGCG
TTACATACACCCAACGTGCAATTTACAATTCACCAGATTTCACTGAATCCGAATGGGAAGTTACTCGCCGTTGCT
GGTGCATTCCAAGTCGCGGTCATCGTTCTTCCCAGACCTGGCTTGACGCGCTTGGTACCCGAGACAATAGACTGC
AAGTCTGTGCAGGTCGGCCAATTCTACCACGCTTCCAAGAATTCCGCTCCTATTGCCAAGATTGAGTGGCATCCC
TGGGGAGAAGCAGCTTCGACTCTACTCGTCATGACAACAGATGGAAAACTACGAGAGTATGACATTTCTGTCGAT
ACTGAAGAACCGCAGCAGGTCTTGTCATTTGTTCCAGAGCGCAAATCAAAATCCTACTTGGCAGAAGATGCATCT
GAGCGGGAAGTCGCATCGTTTGCACTTGGAAAGGGCCGCGCAGACTGGGGTCCTTTGACAGTATACGCGCTTATG
AAGTCCGGTGATATCTACGCCATCTGTCCTTACCTTCCCACAAACGCTTCCGTCCCATCATCCTATATACATTCT
TTAGAATGTTTCATTTCTGCCAAGCAGGAGTTCCTTTCCCAAGATGCTTCAAGGGCATCACCTACGCTTAATGCC
ATCTACGACTACCAACAAAAATACGTCTCCGCACTCCTCAGAGAACTTCCTTCAGGAATAGTCTTTCCTGCGACG
TCCCGAGTTGTTTCCTTACATCCTCCAACCAACATCAAGTCGCCACCCACCCGACAAGGCCCGTTCCTGCTACAA
CCTGAACCCCGTGCATTGGAGGGGAGCGATGGAGGGGACGCTACTGATATAGCTTACCTCGTTTTTGGGACAGAA
TCCGATGATGATGATAATTCCGAGCGCGAGGGTAATCCAACGGAACACTTGGGTATCATCACAGTTGCGTATCAG
GATGGAAAAGTGGATTTATATCTGGATGTGGAGAAAGTCGAAGCGCGTTGGGATGCCACTCATGAATTGATTCGT
GATCTACCAATGCTCGCGGTATACGAAACAATTGACCTCGGAATCTTTTCAACTATCAACTCAATAGCGGACAGT
TGTTTGGATCTCCTTCAAGCCAATCATCCCGTCTTACTGCCTGACCCTATTTATGACGACATCGTTTACGTGTAT
CATGCTTTTGGTGTACATGCACTACATATAGGGCCTGTACTCCAGCATTTGGGTATAGCTCTACGGGGAGCGGAT
GATGAAACTGCTTTGACTGAGGCTCTTCAAAACCCCGTCGAAACACACGTGCAACCTCTACTTACTACATTTTCC
GTGGAGCAAAGATCATCCAATCCTATAATTGGGGTCACTCTGCCAAACGATGTTTATCTCAGTTACAGCATTCTC
ATTTTGACATCTGCTATGCGGATATCTGTCTTTCCATTGACTCTGCGCTCAGAAACTGTTCATGAATCGAACGCA
GAGGCAGCATCAGCCATTCTGACAGGAACAGCACCTCCGGAGAAGAGCAAATGGTTAACACCCGTCGAAGGCTTA
CCACCACCATTCGTGTCGCCTCTAGCGCGCGATCCATTCGAAATTCCTCCTATCTTCAGCGGAAATAGTCTCCCA
AGTGTACCCAGACATTCACTTCCCGCGTCTGTCACCTCAAAAGAGATTCTTCTAACACCAGACGTACTGATGTAT
CTCCTACGCGCAACCGAACACCTGTCTTCTCAAGTGAGGGATATCAACTTCGCCTATTCAGCAGTGAAATTCCGA
AATCAGCTTCAGGAGAAAGAATTGGAGCTTCACGTCAAAGTAGCAGGGATTTTGAACCAAAAAATTGAAAAGTTG
AAAGGTGAAAGGAAATCGGCAATGGACGCTCGCATTGAGAAACTGCATACGACGCAGAAAGAACTCCTAGTACGG
CTCGATCAGTTATTAGCTGCATTGATGCGGGAAGCCTCGCCAGAACTCAGCGAACATGAGGTCAAGTGGTTTGAA
GAACTCAAACGGATGAAGCTGGAAGTTCTCGGCTCTGGAAAGTACGACGCCGACTCCTTAGCGGCCAAAACTAAG
CAGCTGGAAAACGAATATGCGCGTATAACACCCGCCCTCAAAGCAGTATTGGAGAAGGAAAAACTAAGAAAAGAT
AAGCTCGCAGAGGTCAATGGAAGTCTTGGCTTCTCGCAAGCATTCAATTTCGGTCAACAATCCACTGCTGAGCAA
ACGAAAATACATAAACTAGAAAAAAGTGTTTCTAAGCTCGCCGCTCAGTTGAACATCACCCTCGGGAAAATGCCA
CATTCCGAATGA
Transcript >Agabi119p4|071830
ATGTTGCTCAACCCCGCAAACGAGTGGAACGAAGCTCTCAGCGAACATCCCATCTTTTCCCTCCCAAAGGCCTTC
GACGGGCCTCTCGCAGACGCACGGGACTCCCTCGAACTTTCTACAAACACCCTCCCCCGCTTCGTCAAGGTCGAT
CTCCTGGACGATGGACCGGCTCCCTCAGGACGGAGGCAGACTGTGATCCTCAAAGATGCGGACCTCATTGTGGCT
GCTGGAAGAGAAATTCGGATGACGACCCTGGGAGATGCAAAAGGTGGTCAAAGTACGCGAAAGACATACAAGGCG
TTACATACACCCAACGTGCAATTTACAATTCACCAGATTTCACTGAATCCGAATGGGAAGTTACTCGCCGTTGCT
GGTGCATTCCAAGTCGCGGTCATCGTTCTTCCCAGACCTGGCTTGACGCGCTTGGTACCCGAGACAATAGACTGC
AAGTCTGTGCAGGTCGGCCAATTCTACCACGCTTCCAAGAATTCCGCTCCTATTGCCAAGATTGAGTGGCATCCC
TGGGGAGAAGCAGCTTCGACTCTACTCGTCATGACAACAGATGGAAAACTACGAGAGTATGACATTTCTGTCGAT
ACTGAAGAACCGCAGCAGGTCTTGTCATTTGTTCCAGAGCGCAAATCAAAATCCTACTTGGCAGAAGATGCATCT
GAGCGGGAAGTCGCATCGTTTGCACTTGGAAAGGGCCGCGCAGACTGGGGTCCTTTGACAGTATACGCGCTTATG
AAGTCCGGTGATATCTACGCCATCTGTCCTTACCTTCCCACAAACGCTTCCGTCCCATCATCCTATATACATTCT
TTAGAATGTTTCATTTCTGCCAAGCAGGAGTTCCTTTCCCAAGATGCTTCAAGGGCATCACCTACGCTTAATGCC
ATCTACGACTACCAACAAAAATACGTCTCCGCACTCCTCAGAGAACTTCCTTCAGGAATAGTCTTTCCTGCGACG
TCCCGAGTTGTTTCCTTACATCCTCCAACCAACATCAAGTCGCCACCCACCCGACAAGGCCCGTTCCTGCTACAA
CCTGAACCCCGTGCATTGGAGGGGAGCGATGGAGGGGACGCTACTGATATAGCTTACCTCGTTTTTGGGACAGAA
TCCGATGATGATGATAATTCCGAGCGCGAGGGTAATCCAACGGAACACTTGGGTATCATCACAGTTGCGTATCAG
GATGGAAAAGTGGATTTATATCTGGATGTGGAGAAAGTCGAAGCGCGTTGGGATGCCACTCATGAATTGATTCGT
GATCTACCAATGCTCGCGGTATACGAAACAATTGACCTCGGAATCTTTTCAACTATCAACTCAATAGCGGACAGT
TGTTTGGATCTCCTTCAAGCCAATCATCCCGTCTTACTGCCTGACCCTATTTATGACGACATCGTTTACGTGTAT
CATGCTTTTGGTGTACATGCACTACATATAGGGCCTGTACTCCAGCATTTGGGTATAGCTCTACGGGGAGCGGAT
GATGAAACTGCTTTGACTGAGGCTCTTCAAAACCCCGTCGAAACACACGTGCAACCTCTACTTACTACATTTTCC
GTGGAGCAAAGATCATCCAATCCTATAATTGGGGTCACTCTGCCAAACGATGTTTATCTCAGTTACAGCATTCTC
ATTTTGACATCTGCTATGCGGATATCTGTCTTTCCATTGACTCTGCGCTCAGAAACTGTTCATGAATCGAACGCA
GAGGCAGCATCAGCCATTCTGACAGGAACAGCACCTCCGGAGAAGAGCAAATGGTTAACACCCGTCGAAGGCTTA
CCACCACCATTCGTGTCGCCTCTAGCGCGCGATCCATTCGAAATTCCTCCTATCTTCAGCGGAAATAGTCTCCCA
AGTGTACCCAGACATTCACTTCCCGCGTCTGTCACCTCAAAAGAGATTCTTCTAACACCAGACGTACTGATGTAT
CTCCTACGCGCAACCGAACACCTGTCTTCTCAAGTGAGGGATATCAACTTCGCCTATTCAGCAGTGAAATTCCGA
AATCAGCTTCAGGAGAAAGAATTGGAGCTTCACGTCAAAGTAGCAGGGATTTTGAACCAAAAAATTGAAAAGTTG
AAAGGTGAAAGGAAATCGGCAATGGACGCTCGCATTGAGAAACTGCATACGACGCAGAAAGAACTCCTAGTACGG
CTCGATCAGTTATTAGCTGCATTGATGCGGGAAGCCTCGCCAGAACTCAGCGAACATGAGGTCAAGTGGTTTGAA
GAACTCAAACGGATGAAGCTGGAAGTTCTCGGCTCTGGAAAGTACGACGCCGACTCCTTAGCGGCCAAAACTAAG
CAGCTGGAAAACGAATATGCGCGTATAACACCCGCCCTCAAAGCAGTATTGGAGAAGGAAAAACTAAGAAAAGAT
AAGCTCGCAGAGGTCAATGGAAGTCTTGGCTTCTCGCAAGCATTCAATTTCGGTCAACAATCCACTGCTGAGCAA
ACGAAAATACATAAACTAGAAAAAAGTGTTTCTAAGCTCGCCGCTCAGTTGAACATCACCCTCGGGAAAATGCCA
CATTCCGAATGA
Gene >Agabi119p4|071830
ATGTTGCTCAACCCCGCAAACGAGTGGAACGAAGCTCTCAGCGAACATCCCATCTTTTCCCTCCCAAAGGCCTTC
GACGGGCCTCTCGCAGACGCACGGGACTCCCTCGAACTTTCTACAAACACCCTCCCCCGCTTCGTCAAGGTCGAT
CTCCTGGACGATGGACCGGCTCCCTCAGGACGGAGGCAGACTGTGATCCTCAAAGATGCGGACCTCATTGTGGCT
GCTGGAAGAGAAATTCGGATGACGACCCTGGGAGATGCAAAAGGTGGTCAAAGTACGCGAAAGACATACAAGGTA
TTGTGTTGAAGCAATCTACGCATACCCGCCATTGCACTCAACTTCACTCAATAAAGGCGTTACATACACCCAACG
TGCAATTTACAATTCACCAGATTTCACTGAATCCGAATGGGAAGTTACTCGCCGTTGCTGGTGCATTCCAAGTCG
CGGTCATCGTTCTTCCCAGACCTGGCTTGACGCGCTTGGTACCCGAGACAATAGACTGCAAGTATGCGCTCGTTT
CTTCCATTCTAACATGCAATTGACTCGGGTGACACTCTAGGTCTGTGCAGGTCGGCCAATTCTACCACGCTTCCA
AGAATTCCGCTCCTATTGCCAAGATTGAGTGGCATCCCTGGGGAGAAGCAGCTTCGACTCTACTCGTCATGACAA
CAGATGGAAAACTACGGTCCGTTTTGAACCACGCATATTGACTGGACCTTTTTCTGACTTGTGACCAGAGAGTAT
GACATTTCTGTCGATACTGAAGAACCGCAGCAGGTCTTGTCATTTGTTCCAGAGCGCAAATCAAAATCCTACTTG
GCAGAAGATGCATCTGAGCGGGAAGTCGCATCGTTTGCACTTGGAAAGGGCCGCGCAGACTGGGGTCCTTTGACA
GTATACGCGCTTATGAAGTCCGGTGATATCTACGCCATCTGTCCTTACCTTCCCACAAACGCGTATGCCCCTCTT
TGTTTCCTTCATACACATTGCTAATGGCACATCTCGCAGTTCCGTCCCATCATCCTATATACATTCTTTAGAATG
TTTCATTTCTGCCAAGCAGGAGTTCCTTTCCCAAGATGCTTCAAGGGCATCACCTACGCTTAATGCCATCTACGA
CTACCAACAAAAATACGTCTCCGCACTCCTCAGAGAACTTCCTTCAGGAATAGTCTTTCCTGCGACGTCCCGAGT
TGTTTCCTTACATCCTCCAACCAACATCAAGTCGCCACCCACCCGACAAGGCCCGTTCCTGCTACAACCTGAACC
CCGTGCATTGGAGGGGAGCGATGGAGGGGACGCTACTGATATAGCTTACCTCGTTTTTGGGACAGAATCCGATGA
TGATGATAATTCCGAGCGCGAGGGTAATCCAACGGAACACTTGGGTATCATCACAGTTGCGTATCAGGATGGAAA
AGTGGATTTATATCTGGATGTGGAGAAAGTCGAAGCGCGTTGGGATGCCACTCATGTATGCGAAAATCAAGTTGT
TCATACCCTTGTGCTAAAAGAATTTTGCAGGAATTGATTCGTGATCTACCAATGCTCGCGGTATACGAAACAATT
GACCTCGGAATCTTTTCAACTATCAACTCAATAGCGGACAGTTGTTTGGATCTCCTTCAAGCCAATCATCCCGTC
TTACTGCCTGACCCTATTTATGACGACATCGTTTACGTGTATCATGCTTTTGGTGTACATGCACTACATATAGGG
CCTGTACTCCAGCATTTGGGTATAGCTCTACGGGGAGCGGATGATGAAACTGCTTTGACTGAGGCTCTTCAAAAC
CCCGTCGAAACACACGTGCAACCTCTACTTACTACATTTTCCGTGGAGCAAAGGTGTGTCTGTAGTGTTCAATGA
TTGGTAGCTCTCCTTATAAATGCTCTCTAGATCATCCAATCCTATAATTGGGGTCACTCTGCCAAACGATGTTTA
TCTCAGTTACAGCATTCTCATTTTGACATCTGCTATGCGGATATCTGTCTTTCCATTGACTCTGCGCTCAGAAAC
TGTTCATGAATCGAACGCAGAGGCAGCATCAGCCATTCTGACAGGAACAGCACCTCCGGAGAAGAGCAAATGGTT
AACACCCGTCGAAGGCTTACCACCACCATTCGTGTCGCCTCTAGCGCGCGATCCATTCGAAATTCCTCCTATCTT
CAGCGGAAATAGTCTCCCAAGTGTACCCAGACATTCACTTCCCGCGTCTGTCACCTCAAAAGAGATTCTTCTAAC
ACCAGACGTACTGATGTATCTCCTACGCGCAACCGAACACCTGTCTTCTCAAGTGAGGGATATCAACTTCGCCTA
TTCAGCAGTGAAATTCCGAAATCAGCTTCAGGAGAAAGAATTGGAGCTTCACGTCAAAGTAGCAGGGATTTTGAA
CCAAAAAATTGAAAAGTTGAAAGGTGAAAGGAAATCGGCAATGGACGCTCGCATTGAGAAACTGCATACGACGCA
GAAAGAACTCCTAGTACGGCTCGATCAGTTATTAGCTGCATTGATGCGGGAAGCCTCGCCAGAACTCAGCGAACA
TGAGGTCAAGTGGTTTGAAGAACTCAAACGGATGAAGCTGGAAGTTCTCGGCTCTGGAAAGTACGACGCCGACTC
CTTAGCGGCCAAAACTAAGCAGGTAAGTTGCCACGTGCGTTCGAATATTTCCCGAGCCCTGACGATGATTCAAGC
TGGAAAACGAATATGCGCGTATAACACCCGCCCTCAAAGCAGTATTGGAGAAGGAAAAACTAAGAAAAGATAAGC
TCGCAGAGGTCAATGGAAGTCTTGGCTTCTCGCAAGCATTCAATTTCGGTCAACAATCCACTGCTGAGTAAGTTG
AATCGTTTCTGTGTGTCCTTTAACTTATAGTTGTTTCGTAGGCAAACGAAAATACATAAACTAGAAAAAAGTGTT
TCTAAGCTCGCCGCTCAGTTGAACATCACCCTCGGGAAAATGCCACATTCCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail