Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071660
Gene name
Locationscaffold_04:1458348..1460771
Strand-
Gene length (bp)2423
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9 1.0E-115 63 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64890|GUN13_ARATH Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44550 PE=2 SV=1 65 514 2.0E-70
sp|O64889|GUN12_ARATH Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44540 PE=3 SV=1 65 514 9.0E-70
sp|P26221|GUN4_THEFU Endoglucanase E-4 OS=Thermobifida fusca GN=celD PE=1 SV=2 20 543 3.0E-69
sp|Q8S8Q4|GUN14_ARATH Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44560 PE=2 SV=2 65 496 2.0E-65
sp|O80497|GUN15_ARATH Endoglucanase 15 OS=Arabidopsis thaliana GN=At2g44570 PE=3 SV=1 59 514 2.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64890|GUN13_ARATH Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44550 PE=2 SV=1 65 514 2.0E-70
sp|O64889|GUN12_ARATH Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44540 PE=3 SV=1 65 514 9.0E-70
sp|P26221|GUN4_THEFU Endoglucanase E-4 OS=Thermobifida fusca GN=celD PE=1 SV=2 20 543 3.0E-69
sp|Q8S8Q4|GUN14_ARATH Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44560 PE=2 SV=2 65 496 2.0E-65
sp|O80497|GUN15_ARATH Endoglucanase 15 OS=Arabidopsis thaliana GN=At2g44570 PE=3 SV=1 59 514 2.0E-63
sp|Q02934|GUNI_CLOTH Endoglucanase 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celI PE=1 SV=2 66 531 3.0E-60
sp|Q0J930|GUN13_ORYSJ Endoglucanase 13 OS=Oryza sativa subsp. japonica GN=GLU6 PE=2 SV=1 70 514 3.0E-60
sp|Q5YLG1|GUNA_BACPU Endoglucanase A OS=Bacillus pumilus GN=eglA PE=1 SV=1 21 509 5.0E-60
sp|P26224|GUNF_CLOTH Endoglucanase F OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celF PE=3 SV=1 70 510 6.0E-60
sp|Q9M995|GUN5_ARATH Endoglucanase 5 OS=Arabidopsis thaliana GN=At1g48930 PE=2 SV=1 72 514 1.0E-59
sp|A2XYW8|GUN13_ORYSI Endoglucanase 13 OS=Oryza sativa subsp. indica GN=GLU6 PE=3 SV=2 70 514 3.0E-59
sp|Q8L7I0|GUN19_ARATH Endoglucanase 19 OS=Arabidopsis thaliana GN=At4g11050 PE=2 SV=1 70 514 5.0E-59
sp|P22503|GUN_PHAVU Endoglucanase OS=Phaseolus vulgaris PE=2 SV=2 49 510 5.0E-59
sp|Q5NAT8|GUN1_ORYSJ Endoglucanase 1 OS=Oryza sativa subsp. japonica GN=GLU7 PE=2 SV=1 69 512 3.0E-58
sp|Q5NAT0|GUN2_ORYSJ Endoglucanase 2 OS=Oryza sativa subsp. japonica GN=GLU5 PE=1 SV=1 69 514 4.0E-58
sp|O48766|GUN11_ARATH Endoglucanase 11 OS=Arabidopsis thaliana GN=At2g32990 PE=2 SV=1 69 514 2.0E-57
sp|P28622|GUN4_BACS5 Endoglucanase 4 OS=Bacillus sp. (strain KSM-522) PE=3 SV=2 62 509 7.0E-57
sp|Q67UW5|GUN5_ORYSJ Endoglucanase 5 OS=Oryza sativa subsp. japonica GN=Os02g0151300 PE=2 SV=1 69 510 2.0E-56
sp|Q6L4I2|GUN15_ORYSJ Endoglucanase 15 OS=Oryza sativa subsp. japonica GN=Os05g0212300 PE=2 SV=1 69 514 3.0E-56
sp|Q42059|GUN6_ARATH Endoglucanase 6 OS=Arabidopsis thaliana GN=At1g64390 PE=2 SV=2 70 514 4.0E-56
sp|Q8LQ92|GUN3_ORYSJ Endoglucanase 3 OS=Oryza sativa subsp. japonica GN=GLU8 PE=2 SV=1 45 515 3.0E-55
sp|P26225|GUNB_CELFI Endoglucanase B OS=Cellulomonas fimi GN=cenB PE=3 SV=1 70 525 4.0E-55
sp|O81416|GUN17_ARATH Endoglucanase 17 OS=Arabidopsis thaliana GN=At4g02290 PE=2 SV=1 17 515 3.0E-54
sp|Q9SRX3|GUN1_ARATH Endoglucanase 1 OS=Arabidopsis thaliana GN=CEL2 PE=2 SV=1 59 515 7.0E-54
sp|Q9C9H5|GUN9_ARATH Endoglucanase 9 OS=Arabidopsis thaliana GN=CEL3 PE=1 SV=1 48 515 3.0E-52
sp|Q8LCP6|GUN10_ARATH Endoglucanase 10 OS=Arabidopsis thaliana GN=At1g75680 PE=2 SV=2 59 495 9.0E-52
sp|Q6Z5P2|GUN7_ORYSJ Endoglucanase 7 OS=Oryza sativa subsp. japonica GN=GLU10 PE=2 SV=1 57 514 1.0E-51
sp|Q9FXI9|GUN2_ARATH Endoglucanase 2 OS=Arabidopsis thaliana GN=At1g19940 PE=2 SV=1 61 500 2.0E-51
sp|Q2V4L8|GUN3_ARATH Endoglucanase 3 OS=Arabidopsis thaliana GN=CEL5 PE=2 SV=2 66 515 2.0E-51
sp|Q69SG5|GUN24_ORYSJ Endoglucanase 24 OS=Oryza sativa subsp. japonica GN=Os09g0533900 PE=2 SV=1 35 500 6.0E-51
sp|P37700|GUNG_CLOCE Endoglucanase G OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=celCCG PE=1 SV=2 70 525 2.0E-50
sp|Q6K7G9|GUN8_ORYSJ Endoglucanase 8 OS=Oryza sativa subsp. japonica GN=Os02g0778600 PE=2 SV=1 56 500 2.0E-50
sp|Q9CAC1|GUN8_ARATH Endoglucanase 8 OS=Arabidopsis thaliana GN=CEL1 PE=2 SV=1 70 521 2.0E-50
sp|Q5Z9P8|GUN18_ORYSJ Endoglucanase 18 OS=Oryza sativa subsp. japonica GN=Os06g0715300 PE=2 SV=1 56 510 2.0E-50
sp|Q6H3Z9|GUN22_ORYSJ Endoglucanase 22 OS=Oryza sativa subsp. japonica GN=GLU11 PE=2 SV=2 69 514 2.0E-50
sp|Q652F9|GUN17_ORYSJ Endoglucanase 17 OS=Oryza sativa subsp. japonica GN=GLU13 PE=2 SV=1 62 515 4.0E-50
sp|P0C1U5|GUN14_ORYSJ Endoglucanase 14 OS=Oryza sativa subsp. japonica GN=Os05g0129200 PE=2 SV=1 69 514 5.0E-50
sp|Q9SUS0|GUN20_ARATH Endoglucanase 20 OS=Arabidopsis thaliana GN=At4g23560 PE=2 SV=1 61 510 6.0E-50
sp|Q69NF5|GUN23_ORYSJ Endoglucanase 23 OS=Oryza sativa subsp. japonica GN=GLU12 PE=2 SV=1 62 517 8.0E-50
sp|Q84Q51|GUN21_ORYSJ Endoglucanase 21 OS=Oryza sativa subsp. japonica GN=GLU9 PE=2 SV=1 65 522 2.0E-49
sp|Q9SZ90|GUN18_ARATH Endoglucanase 18 OS=Arabidopsis thaliana GN=At4g09740 PE=3 SV=2 66 510 3.0E-49
sp|P05522|GUN1_PERAE Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 SV=1 61 515 5.0E-49
sp|Q8GY58|GUN23_ARATH Endoglucanase 23 OS=Arabidopsis thaliana GN=At4g39000 PE=2 SV=2 54 515 6.0E-49
sp|Q6Z2J3|GUN6_ORYSJ Endoglucanase 6 OS=Oryza sativa subsp. japonica GN=Os02g0733300 PE=2 SV=1 70 515 2.0E-48
sp|Q654U4|GUN16_ORYSJ Endoglucanase 16 OS=Oryza sativa subsp. japonica GN=Os06g0247900 PE=2 SV=2 65 514 3.0E-48
sp|Q6YXT7|GUN19_ORYSJ Endoglucanase 19 OS=Oryza sativa subsp. japonica GN=Os08g0114200 PE=2 SV=1 54 515 4.0E-48
sp|O49296|GUN4_ARATH Endoglucanase 4 OS=Arabidopsis thaliana GN=At1g23210 PE=2 SV=1 53 515 4.0E-48
sp|P22534|GUNA_CALSA Endoglucanase A OS=Caldicellulosiruptor saccharolyticus GN=celA PE=3 SV=2 70 510 6.0E-48
sp|Q9SVJ4|GUN22_ARATH Endoglucanase 22 OS=Arabidopsis thaliana GN=GH9B16 PE=3 SV=1 62 515 9.0E-48
sp|Q6ZA06|GUN20_ORYSJ Endoglucanase 20 OS=Oryza sativa subsp. japonica GN=GLU15 PE=2 SV=1 66 502 7.0E-47
sp|Q93YQ7|GUN24_ARATH Endoglucanase 24 OS=Arabidopsis thaliana GN=At4g39010 PE=2 SV=1 62 515 1.0E-46
sp|Q8VYG3|GUN16_ARATH Endoglucanase 16 OS=Arabidopsis thaliana GN=At3g43860 PE=2 SV=1 70 493 1.0E-46
sp|Q7XTH4|GUN11_ORYSJ Endoglucanase 11 OS=Oryza sativa subsp. japonica GN=GLU4 PE=2 SV=3 56 515 1.0E-45
sp|Q6Z715|GUN4_ORYSJ Endoglucanase 4 OS=Oryza sativa subsp. japonica GN=GLU14 PE=2 SV=1 62 515 2.0E-45
sp|P22699|GUN6_DICDI Endoglucanase OS=Dictyostelium discoideum GN=celA PE=2 SV=1 48 510 4.0E-45
sp|P23659|GUNZ_CLOSR Endoglucanase Z OS=Clostridium stercorarium GN=celZ PE=1 SV=1 70 510 1.0E-42
sp|Q84R49|GUN10_ORYSJ Endoglucanase 10 OS=Oryza sativa subsp. japonica GN=GLU2 PE=2 SV=1 61 507 7.0E-39
sp|Q9STW8|GUN21_ARATH Endoglucanase 21 OS=Arabidopsis thaliana GN=KOR3 PE=2 SV=1 10 507 2.0E-38
sp|Q38890|GUN25_ARATH Endoglucanase 25 OS=Arabidopsis thaliana GN=KOR PE=1 SV=1 10 507 3.0E-35
sp|P0C1U4|GUN9_ORYSJ Endoglucanase 9 OS=Oryza sativa subsp. japonica GN=GLU1 PE=2 SV=1 70 507 1.0E-34
sp|Q7XUK4|GUN12_ORYSJ Endoglucanase 12 OS=Oryza sativa subsp. japonica GN=GLU3 PE=2 SV=2 61 507 3.0E-32
sp|O04478|GUN7_ARATH Endoglucanase 7 OS=Arabidopsis thaliana GN=KOR2 PE=2 SV=1 9 507 1.0E-30
sp|P23666|GUN2_PERAE Endoglucanase 2 (Fragment) OS=Persea americana GN=CEL2 PE=2 SV=1 418 515 7.0E-07
sp|P38534|GUNX_PRUPE Endoglucanase CX (Fragment) OS=Prunus persica PE=2 SV=1 189 442 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 564 586 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071660
MYRAVSFHSASRSMFLSLTVTSLLSLVSLCIAQLPLPVPPYLPPNASFGTIQSPSGRPNSQWTNLLGGLLYFYEA
QRSGQLPSEARVSWRNSSCLDDGKDVGLDLSGGYYDAGDYIKATFPLSFTLMSICWGATDFGQGYDLANQTAYLD
SMLRWGLDWLIKAHPNDNTLYVLVGNPADDDDYWGGDLNIPTPRTSFRVDAAHPGTDVVAGTAAAFAACSNLYRN
KGFRNAPSGPAGLSNTSYADTLLAHAKSLYSFAVSATGGQRLYQESVPALGRSYGSSDYGDELAIAALFLSWATD
SQDLFNQAASYWTQYHLDDEEGVFNWDSKSAGIPILFTQVLQSTTSVSGNIADWHSKAEDYLDKIVQRRSSGMMT
KGGLLYYNGDSDEASLNPAMNAAMLLTRYAPYASSPDKRNSYLKFAQSQVDYALGKNPMSAPYVIGINPNSPSNP
HSAMASGGSNIGAIDTDPVKTTYVLYGAVIGGPDVHDNYFDIRSDWPETEIALDYNAPFLTLAAYNVMQATADPF
YTNLQEGAYAKVKPTGQPCDAAIQTGCSRQRLNHGARIAISVVLTVVILTTVGLIGYCVFWPKRKKVAY*
Coding >Agabi119p4|071660
ATGTATAGAGCGGTATCTTTTCACTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCAGC
CTCGTTTCCCTATGCATTGCACAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCACC
ATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAGCC
CAGCGAAGCGGTCAACTTCCCAGTGAAGCCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAAGAT
GTGGGACTTGATCTGAGTGGTGGATACTATGACGCAGGAGATTATATCAAAGCTACTTTCCCCCTCAGTTTCACG
CTCATGTCTATCTGTTGGGGCGCGACAGACTTTGGTCAAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGAC
AGTATGCTACGCTGGGGACTCGATTGGCTTATTAAAGCCCATCCAAATGACAATACCTTATACGTTTTGGTCGGA
AATCCCGCGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAACCCCTCGAACATCCTTCCGAGTCGAT
GCAGCGCACCCCGGTACCGATGTTGTCGCGGGTACGGCTGCTGCGTTTGCTGCATGTTCCAATCTATACCGCAAT
AAAGGATTCAGGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTCCTACGCTGATACCCTTTTAGCTCAT
GCTAAATCTCTGTACTCGTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCTGTATCAGGAATCCGTTCCTGCCCTC
GGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGCTCTGTTTTTATCCTGGGCAACAGAC
TCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCTAGATGATGAAGAAGGTGTCTTCAAC
TGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTCACTCAAGTTTTACAGAGCACGACCTCCGTCTCTGGTAAC
ATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACAACGTCGCAGCTCAGGAATGATGACC
AAAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATGCTC
CTGACACGCTATGCACCATATGCCTCGTCACCTGACAAAAGAAATTCATATCTGAAATTCGCTCAATCTCAAGTA
GACTATGCTTTGGGCAAGAACCCAATGTCAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCC
CATTCAGCAATGGCTAGCGGCGGATCAAATATCGGCGCAATCGACACCGATCCCGTGAAGACGACATACGTCCTC
TACGGAGCGGTCATCGGTGGACCTGACGTGCATGATAATTATTTCGACATCCGAAGCGATTGGCCGGAAACCGAA
ATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAGCAGCCTATAATGTCATGCAAGCTACAGCTGATCCTTTC
TACACCAATTTACAGGAGGGTGCTTACGCGAAAGTCAAGCCTACTGGACAACCTTGTGATGCCGCCATCCAAACT
GGTTGTTCAAGACAACGACTCAATCATGGAGCTCGTATTGCAATTTCAGTTGTTCTCACTGTCGTTATCCTCACC
ACCGTTGGCCTGATCGGCTATTGCGTCTTCTGGCCGAAGCGCAAGAAGGTTGCATATTAG
Transcript >Agabi119p4|071660
ATGTATAGAGCGGTATCTTTTCACTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCAGC
CTCGTTTCCCTATGCATTGCACAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCACC
ATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAGCC
CAGCGAAGCGGTCAACTTCCCAGTGAAGCCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAAGAT
GTGGGACTTGATCTGAGTGGTGGATACTATGACGCAGGAGATTATATCAAAGCTACTTTCCCCCTCAGTTTCACG
CTCATGTCTATCTGTTGGGGCGCGACAGACTTTGGTCAAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGAC
AGTATGCTACGCTGGGGACTCGATTGGCTTATTAAAGCCCATCCAAATGACAATACCTTATACGTTTTGGTCGGA
AATCCCGCGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAACCCCTCGAACATCCTTCCGAGTCGAT
GCAGCGCACCCCGGTACCGATGTTGTCGCGGGTACGGCTGCTGCGTTTGCTGCATGTTCCAATCTATACCGCAAT
AAAGGATTCAGGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTCCTACGCTGATACCCTTTTAGCTCAT
GCTAAATCTCTGTACTCGTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCTGTATCAGGAATCCGTTCCTGCCCTC
GGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGCTCTGTTTTTATCCTGGGCAACAGAC
TCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCTAGATGATGAAGAAGGTGTCTTCAAC
TGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTCACTCAAGTTTTACAGAGCACGACCTCCGTCTCTGGTAAC
ATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACAACGTCGCAGCTCAGGAATGATGACC
AAAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATGCTC
CTGACACGCTATGCACCATATGCCTCGTCACCTGACAAAAGAAATTCATATCTGAAATTCGCTCAATCTCAAGTA
GACTATGCTTTGGGCAAGAACCCAATGTCAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCC
CATTCAGCAATGGCTAGCGGCGGATCAAATATCGGCGCAATCGACACCGATCCCGTGAAGACGACATACGTCCTC
TACGGAGCGGTCATCGGTGGACCTGACGTGCATGATAATTATTTCGACATCCGAAGCGATTGGCCGGAAACCGAA
ATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAGCAGCCTATAATGTCATGCAAGCTACAGCTGATCCTTTC
TACACCAATTTACAGGAGGGTGCTTACGCGAAAGTCAAGCCTACTGGACAACCTTGTGATGCCGCCATCCAAACT
GGTTGTTCAAGACAACGACTCAATCATGGAGCTCGTATTGCAATTTCAGTTGTTCTCACTGTCGTTATCCTCACC
ACCGTTGGCCTGATCGGCTATTGCGTCTTCTGGCCGAAGCGCAAGAAGGTTGCATATTAG
Gene >Agabi119p4|071660
ATGTATAGAGCGGTATCTTTTCACGTGAGTCTGGTAGACGAAAGGCTATTTTTAGGTTTAATTTCACGGAACGTA
CTTAATGTTGTTAATTGATACTGCAGTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCA
GCCTCGTTTCCCTATGCATTGCACAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCA
CCATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAG
CCCAGCGAAGCGGTCAACTTCCCAGTGAAGCCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAAG
ATGTGGGACTTGATCTGAGTGGTGAGCAGATTCCCTTCAAACTTCCAGTTCGTCGTAATATCGACCCGGTGTACA
GGTGGATACTATGACGCAGGAGGTGATTATCCTCGTTCATCCCTCCTGATTACTCTTGCTCATGCTGTTCGACAA
GATTATATCAAAGCTACTTTCCCCCTCGTAAGTTGATTTTCAGCCTCTTTATGTCGGAACGTGACACATCGTTTC
AGAGTTTCACGCTCATGTCTATCTGTTGGGGCGCGACAGACTTTGGTCAAGGTAAAAAAAAATTGCTCCCGTGTT
CCGTATTGACACTCGATTATCAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGACAGTATGCTACGCTGGGG
ACTCGATTGGCTTATTAAAGTGTGATCCATTTATATATTACTCTCCACTCGGAGCTAATCATACAACTGCCAAGG
CCCATCCAAATGACAATACCTTATACGTTTTGGTCGGAAATCGTCAGTTCATCGAATACGACTTTCCTCCAGAAG
AATATGCCCTGATTTCTTTCCACAAACAGCCGCGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAAC
CCCTCGAACATCCTTCCGAGTCGATGCAGCGCACCCCGGTACCGATGTTGTCGCGGGTACGGCTGCTGCGTTTGC
TGCATGTTCCAATCTATACCGCAATAAAGGATTCAGGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTC
CTACGCTGATACCCTTTTAGCTCATGCTAAATCTCTGTACTCGTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCT
GTATCAGGAATCCGTTCCTGCCCTCGGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGC
TCTGTTTTTATCCTGGGCAACAGACTCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCT
AGATGATGAAGAAGGTGTCTTCAACTGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTCACTCAAGTTTTACA
GAGCACGACCTCCGTCTCTGGTAACATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACA
ACGTCGCAGCTCAGGAATGATGACCAAAGGCACGTCCAATCTACCGTCATGCTCGTTCGAGCTTACTGACTTTTT
GCCATAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATG
CTCCTGACACGCTATGCACCATATGCCTCGTCACCTGACAAAAGAAATTCATATCTGGTTAGTGATTTTCTACCT
CCCGCACGCCCATAGTTCTCATAATATGTAATTACCGTTTGCCATAGAAATTCGCTCAATCTCAAGTAGACTATG
CTTTGGGCAAGAACCCAATGTCAGGTTAGCTCATTCGCCACGGTCCTTTTTACATTTTGACATTACGCCACAAAT
CCTATAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCCCATTCAGCAATGGCTAGCGGCGGA
TCAAATATCGGCGCAATCGACACCGATCCCGTGAAGACGACATACGTCCTCTACGGAGCGGTCATCGGTGGACCT
GACGTGCATGATAATTATTTCGACATCCGAAGCGATTGGCCGGAAACCGAAGTGAGCTACCTTGATAAGTAATTT
CTCGGCTGCGATGGAAATTGACACTTTTCGCATTCTAGATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAG
CAGCCTATAATGTCATGCAAGCTACAGCTGATCCTTTCTACACCAATTTACAGGAGGGTGCTTACGCGAAAGTCA
AGCCTACTGGACAACCTTGTGATGCCGCCATCCAAACTGGTTGTTCAAGACAACGACTCAATCATGGAGCTCGTA
TTGCAATTTCAGTTGTTCTCACTGTCGTTATCCTCACCACCGTTGGCCTGATCGGCTATTGCGTCTTCTGGCCGA
AGCGCAAGAAGGTTGCATATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail