Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071590
Gene name
Locationscaffold_04:1443479..1446677
Strand+
Gene length (bp)3198
Transcript length (bp)2673
Coding sequence length (bp)2673
Protein length (aa) 891

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 7.0E-40 296 442
PF00271 Helicase_C Helicase conserved C-terminal domain 3.9E-24 473 570

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 3 890 0.0E+00
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 8 889 0.0E+00
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 8 889 0.0E+00
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 104 890 0.0E+00
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 128 889 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 3 890 0.0E+00
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 8 889 0.0E+00
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 8 889 0.0E+00
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 104 890 0.0E+00
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 128 889 0.0E+00
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 47 651 0.0E+00
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 128 889 0.0E+00
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 130 651 0.0E+00
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 112 651 0.0E+00
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 104 651 0.0E+00
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 123 651 0.0E+00
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 118 651 0.0E+00
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 102 651 0.0E+00
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 95 889 0.0E+00
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 118 651 0.0E+00
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 135 889 0.0E+00
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 130 651 0.0E+00
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 134 890 0.0E+00
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 134 890 0.0E+00
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 134 890 0.0E+00
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 134 890 0.0E+00
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 134 664 0.0E+00
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 108 890 0.0E+00
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 115 651 0.0E+00
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 51 890 1.0E-172
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 134 890 9.0E-161
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 138 702 1.0E-157
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 203 701 9.0E-153
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 132 890 4.0E-148
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 211 643 5.0E-142
sp|A5DDF4|PRP5_PICGU Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP5 PE=3 SV=2 214 670 1.0E-137
sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 134 662 2.0E-134
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 109 653 6.0E-134
sp|Q9SF41|RH45_ARATH DEAD-box ATP-dependent RNA helicase 45 OS=Arabidopsis thaliana GN=RH45 PE=3 SV=1 105 643 6.0E-129
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 216 658 1.0E-122
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 229 707 5.0E-97
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 158 652 6.0E-97
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 230 609 2.0E-94
sp|A6ZLH6|PRP5_YEAS7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRP5 PE=3 SV=1 135 649 2.0E-92
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 221 648 2.0E-92
sp|P21372|PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP5 PE=1 SV=1 135 649 2.0E-92
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 134 609 3.0E-92
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 231 611 2.0E-91
sp|Q6FML5|PRP5_CANGA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP5 PE=3 SV=1 128 642 2.0E-90
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 213 609 2.0E-90
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 218 633 2.0E-90
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 218 633 3.0E-90
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 11 441 4.0E-90
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 133 609 2.0E-88
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 218 633 2.0E-88
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 218 609 2.0E-88
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 218 609 2.0E-88
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 218 633 2.0E-88
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 218 608 1.0E-87
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 230 631 3.0E-87
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 231 609 5.0E-87
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 231 609 6.0E-87
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 108 633 2.0E-86
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 231 609 2.0E-86
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 231 609 6.0E-86
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 231 609 6.0E-86
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 231 610 2.0E-85
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 134 609 1.0E-84
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 231 610 2.0E-84
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 231 611 3.0E-84
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 230 605 2.0E-83
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 231 605 2.0E-82
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 231 605 2.0E-82
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 231 606 3.0E-82
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 231 608 4.0E-82
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 231 605 4.0E-82
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 231 605 1.0E-81
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 231 609 8.0E-81
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 231 605 1.0E-80
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 230 609 2.0E-80
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 231 609 2.0E-80
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 231 609 1.0E-79
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 231 609 1.0E-79
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 231 609 5.0E-79
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 231 609 6.0E-79
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 231 609 2.0E-78
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 221 609 2.0E-78
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 231 609 1.0E-77
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 231 609 3.0E-77
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 231 609 3.0E-77
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 231 609 1.0E-76
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 231 609 1.0E-76
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 231 609 8.0E-75
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 231 609 6.0E-74
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 231 609 1.0E-73
sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 214 606 1.0E-73
sp|Q26696|DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei GN=HEL64 PE=3 SV=1 240 608 2.0E-73
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 231 609 1.0E-72
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 260 634 4.0E-71
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 258 610 8.0E-70
sp|A5DS77|DBP2_LODEL ATP-dependent RNA helicase DBP2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP2 PE=3 SV=1 231 606 2.0E-69
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 230 612 3.0E-68
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 260 630 2.0E-67
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 260 610 9.0E-67
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 260 606 9.0E-65
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 260 609 6.0E-64
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 260 609 3.0E-63
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 242 605 2.0E-62
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 244 605 6.0E-62
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 260 609 1.0E-61
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 232 630 3.0E-61
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 260 610 6.0E-61
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3 230 612 2.0E-60
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 260 631 3.0E-60
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 264 607 3.0E-60
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 264 607 3.0E-60
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 233 609 4.0E-60
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 260 630 7.0E-60
sp|A7TTT5|DBP2_VANPO ATP-dependent RNA helicase DBP2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP2 PE=3 SV=1 231 539 1.0E-59
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 477 673 2.0E-59
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 260 609 2.0E-59
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 260 631 2.0E-59
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 260 610 2.0E-59
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 260 609 2.0E-59
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 260 631 4.0E-59
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 230 610 5.0E-59
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 260 609 2.0E-58
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 260 653 4.0E-58
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 260 631 5.0E-58
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 260 605 1.0E-57
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 260 580 2.0E-57
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 269 605 2.0E-57
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 259 600 2.0E-57
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 259 600 2.0E-57
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 279 628 3.0E-57
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 292 605 5.0E-57
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 245 605 9.0E-57
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 264 609 4.0E-56
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 264 609 4.0E-56
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 274 595 5.0E-56
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 270 628 6.0E-56
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 269 605 2.0E-55
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 255 605 2.0E-55
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 260 609 3.0E-55
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 270 605 4.0E-55
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 260 609 5.0E-55
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 269 605 7.0E-55
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 260 633 1.0E-54
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 260 609 1.0E-54
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 260 609 2.0E-54
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 260 629 2.0E-54
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 260 609 3.0E-54
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 269 605 3.0E-54
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 260 609 3.0E-54
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 260 609 3.0E-54
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 236 605 4.0E-54
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 260 609 1.0E-53
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 264 630 2.0E-53
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 235 622 2.0E-53
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 269 621 2.0E-53
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 226 611 2.0E-53
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 274 597 3.0E-53
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 260 609 3.0E-53
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 226 611 3.0E-53
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 260 610 4.0E-53
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 291 605 4.0E-53
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 260 609 5.0E-53
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 269 628 6.0E-53
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 260 605 6.0E-53
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 269 628 6.0E-53
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 269 628 6.0E-53
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 260 609 6.0E-53
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 226 609 1.0E-52
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 236 628 2.0E-52
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 259 585 2.0E-52
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 264 609 2.0E-52
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 236 609 2.0E-52
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 258 609 2.0E-52
sp|P0CQ74|DED1_CRYNJ ATP-dependent RNA helicase ded1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DED1 PE=3 SV=1 260 610 3.0E-52
sp|P0CQ75|DED1_CRYNB ATP-dependent RNA helicase ded1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DED1 PE=3 SV=1 260 610 3.0E-52
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 272 603 4.0E-52
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 236 628 4.0E-52
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 272 597 5.0E-52
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 232 611 5.0E-52
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 264 609 6.0E-52
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 260 687 7.0E-52
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 272 597 9.0E-52
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 272 597 9.0E-52
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 272 597 9.0E-52
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 260 609 1.0E-51
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 272 597 1.0E-51
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 236 651 2.0E-51
sp|Q5T1V6|DDX59_HUMAN Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1 240 605 3.0E-51
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 272 597 4.0E-51
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 214 625 4.0E-51
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 260 608 5.0E-51
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 269 609 5.0E-51
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 260 609 1.0E-50
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 283 634 2.0E-50
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 283 634 2.0E-50
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 274 698 2.0E-50
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 260 609 3.0E-50
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 264 580 3.0E-50
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 269 628 5.0E-50
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 225 628 6.0E-50
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 271 698 9.0E-50
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 269 605 1.0E-49
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 273 586 1.0E-49
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 273 586 1.0E-49
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 226 634 1.0E-49
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 274 648 2.0E-49
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 274 581 2.0E-49
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 274 581 3.0E-49
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 274 595 3.0E-49
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 274 595 5.0E-49
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 260 609 8.0E-49
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 177 607 1.0E-48
sp|Q9FZ92|RH44_ARATH Putative DEAD-box ATP-dependent RNA helicase 44 OS=Arabidopsis thaliana GN=RH44 PE=5 SV=2 259 605 1.0E-48
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 298 602 3.0E-48
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 269 605 4.0E-48
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 284 610 4.0E-48
sp|P0CQ79|DBP3_CRYNB ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP3 PE=3 SV=1 292 606 4.0E-48
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 298 626 5.0E-48
sp|Q6CT46|DBP3_KLULA ATP-dependent RNA helicase DBP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP3 PE=3 SV=1 292 610 6.0E-48
sp|P0CQ78|DBP3_CRYNJ ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP3 PE=3 SV=1 292 606 6.0E-48
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 269 605 7.0E-48
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 271 586 1.0E-47
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 269 605 1.0E-47
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 298 585 1.0E-47
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 273 590 2.0E-47
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 273 590 2.0E-47
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 273 590 2.0E-47
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 273 578 2.0E-47
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 269 605 3.0E-47
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 271 595 3.0E-47
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 271 595 3.0E-47
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 271 595 3.0E-47
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 271 595 3.0E-47
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 271 595 4.0E-47
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 273 592 4.0E-47
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 274 597 4.0E-47
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 271 595 6.0E-47
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 242 605 8.0E-47
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 279 609 9.0E-47
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 274 583 1.0E-46
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 271 580 1.0E-46
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 283 580 1.0E-46
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 274 599 1.0E-46
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 271 583 1.0E-46
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 269 605 1.0E-46
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 274 593 2.0E-46
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 274 593 2.0E-46
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 274 593 2.0E-46
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 273 578 2.0E-46
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 273 590 2.0E-46
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 271 595 4.0E-46
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 298 585 4.0E-46
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 274 593 6.0E-46
sp|Q66HG7|DDX59_RAT Probable ATP-dependent RNA helicase DDX59 OS=Rattus norvegicus GN=Ddx59 PE=2 SV=1 235 622 6.0E-46
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 287 608 7.0E-46
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 272 580 9.0E-46
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 260 609 1.0E-45
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 260 609 1.0E-45
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 274 606 2.0E-45
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 274 581 2.0E-45
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 274 581 3.0E-45
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 260 609 3.0E-45
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 274 581 4.0E-45
sp|B2VG58|RHLB_ERWT9 ATP-dependent RNA helicase RhlB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rhlB PE=3 SV=1 273 582 4.0E-45
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 269 624 5.0E-45
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 271 649 5.0E-45
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 273 578 8.0E-45
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 284 580 9.0E-45
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 292 609 1.0E-44
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 241 584 1.0E-44
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 274 622 1.0E-44
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 260 609 2.0E-44
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 242 605 2.0E-44
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 292 609 3.0E-44
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 292 608 4.0E-44
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 274 648 4.0E-44
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 273 608 4.0E-44
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 272 608 4.0E-44
sp|A4WG30|RHLB_ENT38 ATP-dependent RNA helicase RhlB OS=Enterobacter sp. (strain 638) GN=rhlB PE=3 SV=1 273 603 7.0E-44
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 282 627 7.0E-44
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 290 661 9.0E-44
sp|Q2NQB2|RHLB_SODGM ATP-dependent RNA helicase RhlB OS=Sodalis glossinidius (strain morsitans) GN=rhlB PE=3 SV=1 273 582 9.0E-44
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 274 608 1.0E-43
sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 278 608 1.0E-43
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 273 590 1.0E-43
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 274 590 1.0E-43
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 274 590 1.0E-43
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 274 580 1.0E-43
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 274 580 1.0E-43
sp|B1JQ11|RHLB_YERPY ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|Q66G19|RHLB_YERPS ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|A4TRC8|RHLB_YERPP ATP-dependent RNA helicase RhlB OS=Yersinia pestis (strain Pestoides F) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|Q1CNK3|RHLB_YERPN ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|Q8ZAD8|RHLB_YERPE ATP-dependent RNA helicase RhlB OS=Yersinia pestis GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|B2K046|RHLB_YERPB ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|Q1CBQ4|RHLB_YERPA ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|A7FD47|RHLB_YERP3 ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rhlB PE=3 SV=1 273 602 2.0E-43
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 287 609 2.0E-43
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 274 614 2.0E-43
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 274 595 2.0E-43
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 274 614 2.0E-43
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 274 596 2.0E-43
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 266 590 2.0E-43
sp|Q40468|IF415_TOBAC Eukaryotic initiation factor 4A-15 OS=Nicotiana tabacum PE=2 SV=1 278 608 2.0E-43
sp|Q9DF35|DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis GN=ddx21-a PE=2 SV=2 288 593 2.0E-43
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 274 617 2.0E-43
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 274 580 3.0E-43
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 270 608 3.0E-43
sp|Q9CAI7|IF4A3_ARATH Eukaryotic initiation factor 4A-3 OS=Arabidopsis thaliana GN=TIF4A-3 PE=1 SV=1 287 608 3.0E-43
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 274 595 3.0E-43
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 287 580 4.0E-43
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 287 580 4.0E-43
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 273 582 5.0E-43
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 292 608 5.0E-43
sp|Q40471|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1 278 608 5.0E-43
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 269 590 5.0E-43
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 274 661 5.0E-43
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 269 590 5.0E-43
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 295 579 5.0E-43
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 272 584 6.0E-43
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 287 597 6.0E-43
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 269 590 6.0E-43
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 269 590 6.0E-43
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 269 590 6.0E-43
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 266 590 7.0E-43
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 274 595 8.0E-43
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 269 590 9.0E-43
sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 274 608 9.0E-43
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 278 608 1.0E-42
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 274 580 1.0E-42
sp|Q40465|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1 278 608 1.0E-42
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 273 603 1.0E-42
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 274 608 1.0E-42
sp|A8G828|RHLB_SERP5 ATP-dependent RNA helicase RhlB OS=Serratia proteamaculans (strain 568) GN=rhlB PE=3 SV=1 273 602 1.0E-42
sp|Q650T9|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Oryza sativa subsp. japonica GN=Os09g0520700 PE=2 SV=1 298 603 1.0E-42
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 273 602 2.0E-42
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 271 609 2.0E-42
sp|C4K8M8|RHLB_HAMD5 ATP-dependent RNA helicase RhlB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rhlB PE=3 SV=1 273 578 2.0E-42
sp|B7VME9|RHLB_VIBTL ATP-dependent RNA helicase RhlB OS=Vibrio tasmaniensis (strain LGP32) GN=rhlB PE=3 SV=1 288 608 2.0E-42
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 269 590 2.0E-42
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 278 608 2.0E-42
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 278 608 2.0E-42
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 278 608 2.0E-42
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 295 579 2.0E-42
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 274 597 2.0E-42
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 278 608 2.0E-42
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 273 582 2.0E-42
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 278 608 3.0E-42
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 287 608 3.0E-42
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 274 597 3.0E-42
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 264 608 3.0E-42
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 274 579 3.0E-42
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 292 588 3.0E-42
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 278 608 3.0E-42
sp|Q9DF36|DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis GN=ddx21-b PE=2 SV=2 285 593 3.0E-42
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 270 604 4.0E-42
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 278 608 4.0E-42
sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 278 608 5.0E-42
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 274 584 5.0E-42
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 290 601 5.0E-42
sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 278 608 6.0E-42
sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 278 608 7.0E-42
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 273 582 7.0E-42
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 290 610 1.0E-41
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 273 602 1.0E-41
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 278 608 1.0E-41
sp|P41379|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1 278 608 1.0E-41
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 274 597 1.0E-41
sp|Q40470|IF4A7_TOBAC Eukaryotic initiation factor 4A-7 OS=Nicotiana tabacum PE=2 SV=1 278 608 2.0E-41
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 295 579 2.0E-41
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 272 617 2.0E-41
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 258 608 2.0E-41
sp|B5XYY9|RHLB_KLEP3 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae (strain 342) GN=rhlB PE=3 SV=1 273 602 2.0E-41
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 255 582 2.0E-41
sp|Q31UK5|RHLB_SHIBS ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 4 (strain Sb227) GN=rhlB PE=3 SV=1 273 602 2.0E-41
sp|B2TU12|RHLB_SHIB3 ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhlB PE=3 SV=1 273 602 2.0E-41
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 275 616 2.0E-41
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 271 597 2.0E-41
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 266 590 3.0E-41
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 274 608 3.0E-41
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 273 602 3.0E-41
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 287 609 3.0E-41
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 287 609 3.0E-41
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 271 579 3.0E-41
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 273 602 3.0E-41
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 274 597 3.0E-41
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 295 579 3.0E-41
sp|A6TGG9|RHLB_KLEP7 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 278 608 4.0E-41
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 273 602 4.0E-41
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 273 602 4.0E-41
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 273 602 4.0E-41
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 273 596 5.0E-41
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 278 608 5.0E-41
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 274 676 5.0E-41
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 273 602 5.0E-41
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 282 608 5.0E-41
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 273 602 5.0E-41
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 274 608 5.0E-41
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 273 602 5.0E-41
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 271 588 5.0E-41
sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1 274 606 6.0E-41
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 271 624 6.0E-41
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 272 579 6.0E-41
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 292 608 6.0E-41
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 274 608 6.0E-41
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 271 581 6.0E-41
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 273 602 6.0E-41
sp|Q81E85|CSHC_BACCR DEAD-box ATP-dependent RNA helicase CshC OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshC PE=2 SV=1 296 585 6.0E-41
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 282 608 7.0E-41
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 273 582 7.0E-41
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 273 602 7.0E-41
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 273 602 7.0E-41
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 273 602 7.0E-41
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 273 602 7.0E-41
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 273 602 8.0E-41
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 292 606 8.0E-41
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 282 608 8.0E-41
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 273 582 8.0E-41
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 287 610 8.0E-41
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 273 602 9.0E-41
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 296 602 9.0E-41
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 287 608 1.0E-40
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 285 578 1.0E-40
sp|B1LLV3|RHLB_ECOSM ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhlB PE=3 SV=1 273 602 1.0E-40
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 274 608 1.0E-40
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 268 590 1.0E-40
sp|P41377|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1 278 608 1.0E-40
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 274 590 1.0E-40
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 268 580 2.0E-40
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 269 579 2.0E-40
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 229 606 2.0E-40
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 273 616 2.0E-40
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 270 580 2.0E-40
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 290 610 3.0E-40
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 278 608 3.0E-40
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 234 588 3.0E-40
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 274 580 4.0E-40
sp|Q8XAT4|RHLB_ECO57 ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 GN=rhlB PE=3 SV=3 273 602 4.0E-40
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 274 590 4.0E-40
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 273 602 4.0E-40
sp|Q86IZ9|DDX52_DICDI Probable ATP-dependent RNA helicase ddx52 OS=Dictyostelium discoideum GN=ddx52 PE=3 SV=1 260 659 4.0E-40
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 292 592 5.0E-40
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 292 606 5.0E-40
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 274 595 5.0E-40
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 274 597 5.0E-40
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 273 602 7.0E-40
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 271 608 7.0E-40
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 296 602 8.0E-40
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 296 602 8.0E-40
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 271 608 9.0E-40
sp|Q9CJS1|RHLB_PASMU ATP-dependent RNA helicase RhlB OS=Pasteurella multocida (strain Pm70) GN=rhlB PE=3 SV=1 288 609 1.0E-39
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 242 441 1.0E-39
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 292 588 1.0E-39
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 273 602 1.0E-39
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 292 580 1.0E-39
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 287 608 1.0E-39
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 295 579 1.0E-39
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 287 608 1.0E-39
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 287 590 1.0E-39
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 287 608 2.0E-39
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 296 602 2.0E-39
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 274 602 2.0E-39
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 274 590 2.0E-39
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 287 608 2.0E-39
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 274 580 2.0E-39
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 274 597 2.0E-39
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 287 608 2.0E-39
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 273 582 3.0E-39
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 258 606 3.0E-39
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 283 582 3.0E-39
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 296 616 3.0E-39
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 296 616 3.0E-39
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 292 606 3.0E-39
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 290 588 3.0E-39
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 752 890 1.0E-24
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 752 890 2.0E-24
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 764 889 2.0E-24
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 459 605 2.0E-24
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 752 890 1.0E-23
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 739 890 4.0E-23
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 752 890 3.0E-22
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 752 890 3.0E-22
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 752 890 5.0E-20
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 781 890 5.0E-17
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 783 889 1.0E-15
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 783 889 1.0E-15
sp|Q9SF41|RH45_ARATH DEAD-box ATP-dependent RNA helicase 45 OS=Arabidopsis thaliana GN=RH45 PE=3 SV=1 788 890 3.0E-13
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 783 867 1.0E-11
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 783 889 2.0E-11
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 783 889 7.0E-11
sp|A6ZLH6|PRP5_YEAS7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRP5 PE=3 SV=1 784 876 3.0E-10
sp|P21372|PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP5 PE=1 SV=1 784 876 3.0E-10
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 779 861 6.0E-10
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 779 859 2.0E-09
sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 788 874 8.0E-09
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 778 859 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071590
MRAKRAKLEAWKKEREAKKALDEAKAKAMALAGRAAPAPATKTGQLNRAALGGLGLKGLPLKPEFSVVKGLASMD
DSVETKRKLETLGDMPAVDMSMKDDATVGDLEVDDDDEEANRMDQALKAKAKDTMEVAEEDEVDPLDAFMSGVKE
EVKKVNMEDMQKMITTNGLQSRVRLDDQMGDDGVEAEVEGTVDELDATELNPEDILALAAKKAKKKELATVDHSR
IHYEPFRKEFYVPPPDIAHMTDDEAELLRLELDSIKIRGIDCPRPVTKWSHFGMPANCLDVIKRLNYTAPTSIQA
QAIPAIMSGRDVIGVAKTGSGKTIAFLMPLFRHIKDQRPLEQMEGPIAVVMTPTRELAVQIHKDCKPFLKVLGLR
AVCAYGGSPIKDQIAELKKGAEIIVCTPGRMIDLLTANSGRVTNLKRVTYVVLDEADHKPSFSLQPFPNKWIRLR
GKFYESPLKLLSVADQLLQPKLNKLSRTLIFVDRQEAADNLLRELMRKGYLCMSLHGGKDQVDRDQTIADFKSGV
VPIVIATSVAARGLDVKQLKLVINHDAPNHMEDYVHRAGRTGRAGNKGTCVTFITPEQDRYSVDIHRALKASNAS
IPQELEDLANGFLEKVKSGKAQAAGSGFGGKGLDRLDKERDAREKAERKAYGEPTDEDKPEAIAPAGAAAKVENA
GVVSNDDMNFGNFKVEIKRGPAPDSSKGLLGVSGAVAAARRLAHAKEEERIQSQMRAAEEAAARAGKDTPAHKQA
LNVVAKLNAQLRASKLVLQSQLQAEESGRKINPDSTDFHAIIPINDYPQKARWRVTNKETMTQLIDMTGASVTNK
GIYYETGKEPPAEGPPKLHLLIESNEEYRVEQAVREIKRLLIEASAAAIQAEMRNPTATGRYSVL*
Coding >Agabi119p4|071590
ATGAGAGCCAAGCGCGCTAAACTAGAGGCATGGAAAAAAGAACGTGAAGCAAAGAAGGCTCTCGACGAGGCCAAG
GCCAAAGCCATGGCCCTCGCCGGGAGGGCTGCACCTGCCCCCGCAACCAAGACTGGCCAACTCAATCGCGCTGCG
CTTGGAGGTTTAGGTCTCAAGGGTCTTCCCCTAAAACCCGAGTTCTCGGTCGTCAAGGGTCTCGCTTCAATGGAT
GATTCTGTAGAAACAAAGCGCAAATTAGAGACTTTGGGGGATATGCCCGCCGTTGACATGAGCATGAAGGACGAC
GCGACTGTTGGTGACCTAGAAGTAGATGATGATGATGAGGAAGCCAACAGAATGGACCAAGCATTGAAAGCCAAG
GCGAAAGATACCATGGAAGTCGCTGAAGAGGACGAAGTCGATCCTCTCGATGCCTTCATGAGTGGGGTCAAAGAA
GAGGTCAAGAAAGTGAATATGGAAGACATGCAGAAAATGATAACTACCAATGGCCTTCAGTCTCGGGTTCGTTTG
GATGACCAGATGGGAGATGATGGCGTGGAGGCCGAAGTAGAGGGTACCGTTGATGAACTCGATGCAACGGAACTC
AATCCGGAGGATATCCTCGCTCTGGCCGCAAAAAAGGCGAAAAAAAAAGAGTTGGCCACAGTCGATCATTCACGT
ATTCATTATGAGCCGTTCAGAAAGGAATTTTATGTCCCTCCACCTGATATCGCACATATGACTGACGATGAAGCT
GAATTACTGCGCCTTGAGCTGGACAGCATCAAAATCCGTGGTATTGATTGCCCTCGCCCCGTCACAAAATGGAGC
CATTTTGGCATGCCTGCCAACTGTCTCGACGTTATCAAGCGCTTGAACTATACTGCCCCGACATCTATCCAAGCC
CAAGCCATACCTGCCATCATGTCTGGCCGAGACGTTATTGGTGTAGCCAAGACTGGTTCCGGTAAAACAATCGCC
TTTCTAATGCCCTTATTCCGTCACATCAAGGACCAGCGTCCTCTCGAACAAATGGAAGGCCCCATTGCAGTCGTC
ATGACTCCGACACGCGAGTTGGCTGTCCAGATTCACAAAGATTGTAAGCCCTTTTTGAAAGTATTGGGTCTACGG
GCTGTATGTGCATACGGCGGTTCGCCTATCAAGGATCAAATTGCAGAACTTAAAAAGGGAGCTGAAATCATCGTC
TGCACACCCGGTCGCATGATAGATTTGCTGACGGCCAATTCAGGTCGCGTCACCAATCTCAAACGGGTGACTTAC
GTTGTTCTTGACGAAGCTGACCACAAACCGTCCTTTTCTCTGCAACCTTTCCCAAACAAATGGATTCGCTTGCGC
GGAAAATTTTACGAAAGCCCCTTGAAATTACTGTCGGTGGCAGATCAGTTGTTGCAGCCGAAATTGAACAAATTG
TCGAGAACCTTGATCTTTGTTGACCGACAAGAAGCTGCTGATAACCTTCTCCGAGAACTTATGCGCAAAGGCTAT
CTCTGCATGTCGCTTCATGGGGGGAAGGATCAAGTAGACCGTGATCAAACTATCGCAGATTTCAAGTCTGGCGTC
GTCCCCATCGTTATCGCGACTTCAGTAGCTGCTCGTGGTCTGGACGTGAAGCAACTTAAATTGGTCATTAATCAT
GATGCTCCGAACCACATGGAAGACTATGTTCATCGCGCTGGGCGTACGGGTCGCGCTGGTAATAAGGGTACATGT
GTTACATTTATTACACCCGAACAGGATCGCTATTCAGTTGATATTCATCGCGCTCTCAAGGCTAGTAACGCCTCA
ATTCCGCAAGAATTAGAGGACTTGGCAAACGGTTTCCTCGAGAAAGTCAAATCAGGGAAAGCTCAGGCTGCTGGT
TCCGGATTTGGTGGAAAGGGCTTAGATCGACTAGATAAAGAACGTGATGCCCGCGAAAAGGCAGAAAGGAAAGCA
TATGGCGAGCCAACAGATGAAGACAAGCCTGAAGCAATCGCCCCCGCCGGGGCAGCGGCCAAAGTAGAAAACGCT
GGTGTTGTTAGTAACGATGATATGAACTTTGGCAACTTCAAGGTCGAAATCAAGCGTGGTCCCGCACCAGATTCA
TCTAAAGGCCTTTTGGGAGTCTCAGGAGCGGTCGCTGCTGCGCGTCGCCTTGCACATGCCAAGGAGGAAGAGAGA
ATACAGAGTCAGATGCGCGCGGCTGAAGAAGCTGCTGCTCGTGCAGGCAAAGATACTCCAGCTCATAAGCAAGCT
TTGAATGTAGTGGCGAAGTTGAATGCGCAGCTTAGAGCATCGAAATTGGTGTTACAGTCACAGTTACAAGCGGAG
GAATCTGGGCGCAAGATCAATCCCGATTCAACTGATTTCCATGCCATCATACCCATCAATGATTATCCTCAGAAA
GCCCGTTGGCGTGTTACCAACAAGGAGACCATGACCCAGCTCATCGACATGACTGGTGCTTCAGTTACTAATAAA
GGTATTTATTATGAAACTGGAAAAGAGCCACCAGCCGAGGGACCGCCCAAACTCCATCTACTTATTGAATCAAAT
GAAGAATACAGGGTTGAGCAAGCGGTACGCGAAATCAAGCGTCTACTCATAGAAGCGTCTGCTGCTGCCATACAG
GCAGAAATGCGGAACCCAACGGCAACTGGCAGGTATAGTGTTCTCTAA
Transcript >Agabi119p4|071590
ATGAGAGCCAAGCGCGCTAAACTAGAGGCATGGAAAAAAGAACGTGAAGCAAAGAAGGCTCTCGACGAGGCCAAG
GCCAAAGCCATGGCCCTCGCCGGGAGGGCTGCACCTGCCCCCGCAACCAAGACTGGCCAACTCAATCGCGCTGCG
CTTGGAGGTTTAGGTCTCAAGGGTCTTCCCCTAAAACCCGAGTTCTCGGTCGTCAAGGGTCTCGCTTCAATGGAT
GATTCTGTAGAAACAAAGCGCAAATTAGAGACTTTGGGGGATATGCCCGCCGTTGACATGAGCATGAAGGACGAC
GCGACTGTTGGTGACCTAGAAGTAGATGATGATGATGAGGAAGCCAACAGAATGGACCAAGCATTGAAAGCCAAG
GCGAAAGATACCATGGAAGTCGCTGAAGAGGACGAAGTCGATCCTCTCGATGCCTTCATGAGTGGGGTCAAAGAA
GAGGTCAAGAAAGTGAATATGGAAGACATGCAGAAAATGATAACTACCAATGGCCTTCAGTCTCGGGTTCGTTTG
GATGACCAGATGGGAGATGATGGCGTGGAGGCCGAAGTAGAGGGTACCGTTGATGAACTCGATGCAACGGAACTC
AATCCGGAGGATATCCTCGCTCTGGCCGCAAAAAAGGCGAAAAAAAAAGAGTTGGCCACAGTCGATCATTCACGT
ATTCATTATGAGCCGTTCAGAAAGGAATTTTATGTCCCTCCACCTGATATCGCACATATGACTGACGATGAAGCT
GAATTACTGCGCCTTGAGCTGGACAGCATCAAAATCCGTGGTATTGATTGCCCTCGCCCCGTCACAAAATGGAGC
CATTTTGGCATGCCTGCCAACTGTCTCGACGTTATCAAGCGCTTGAACTATACTGCCCCGACATCTATCCAAGCC
CAAGCCATACCTGCCATCATGTCTGGCCGAGACGTTATTGGTGTAGCCAAGACTGGTTCCGGTAAAACAATCGCC
TTTCTAATGCCCTTATTCCGTCACATCAAGGACCAGCGTCCTCTCGAACAAATGGAAGGCCCCATTGCAGTCGTC
ATGACTCCGACACGCGAGTTGGCTGTCCAGATTCACAAAGATTGTAAGCCCTTTTTGAAAGTATTGGGTCTACGG
GCTGTATGTGCATACGGCGGTTCGCCTATCAAGGATCAAATTGCAGAACTTAAAAAGGGAGCTGAAATCATCGTC
TGCACACCCGGTCGCATGATAGATTTGCTGACGGCCAATTCAGGTCGCGTCACCAATCTCAAACGGGTGACTTAC
GTTGTTCTTGACGAAGCTGACCACAAACCGTCCTTTTCTCTGCAACCTTTCCCAAACAAATGGATTCGCTTGCGC
GGAAAATTTTACGAAAGCCCCTTGAAATTACTGTCGGTGGCAGATCAGTTGTTGCAGCCGAAATTGAACAAATTG
TCGAGAACCTTGATCTTTGTTGACCGACAAGAAGCTGCTGATAACCTTCTCCGAGAACTTATGCGCAAAGGCTAT
CTCTGCATGTCGCTTCATGGGGGGAAGGATCAAGTAGACCGTGATCAAACTATCGCAGATTTCAAGTCTGGCGTC
GTCCCCATCGTTATCGCGACTTCAGTAGCTGCTCGTGGTCTGGACGTGAAGCAACTTAAATTGGTCATTAATCAT
GATGCTCCGAACCACATGGAAGACTATGTTCATCGCGCTGGGCGTACGGGTCGCGCTGGTAATAAGGGTACATGT
GTTACATTTATTACACCCGAACAGGATCGCTATTCAGTTGATATTCATCGCGCTCTCAAGGCTAGTAACGCCTCA
ATTCCGCAAGAATTAGAGGACTTGGCAAACGGTTTCCTCGAGAAAGTCAAATCAGGGAAAGCTCAGGCTGCTGGT
TCCGGATTTGGTGGAAAGGGCTTAGATCGACTAGATAAAGAACGTGATGCCCGCGAAAAGGCAGAAAGGAAAGCA
TATGGCGAGCCAACAGATGAAGACAAGCCTGAAGCAATCGCCCCCGCCGGGGCAGCGGCCAAAGTAGAAAACGCT
GGTGTTGTTAGTAACGATGATATGAACTTTGGCAACTTCAAGGTCGAAATCAAGCGTGGTCCCGCACCAGATTCA
TCTAAAGGCCTTTTGGGAGTCTCAGGAGCGGTCGCTGCTGCGCGTCGCCTTGCACATGCCAAGGAGGAAGAGAGA
ATACAGAGTCAGATGCGCGCGGCTGAAGAAGCTGCTGCTCGTGCAGGCAAAGATACTCCAGCTCATAAGCAAGCT
TTGAATGTAGTGGCGAAGTTGAATGCGCAGCTTAGAGCATCGAAATTGGTGTTACAGTCACAGTTACAAGCGGAG
GAATCTGGGCGCAAGATCAATCCCGATTCAACTGATTTCCATGCCATCATACCCATCAATGATTATCCTCAGAAA
GCCCGTTGGCGTGTTACCAACAAGGAGACCATGACCCAGCTCATCGACATGACTGGTGCTTCAGTTACTAATAAA
GGTATTTATTATGAAACTGGAAAAGAGCCACCAGCCGAGGGACCGCCCAAACTCCATCTACTTATTGAATCAAAT
GAAGAATACAGGGTTGAGCAAGCGGTACGCGAAATCAAGCGTCTACTCATAGAAGCGTCTGCTGCTGCCATACAG
GCAGAAATGCGGAACCCAACGGCAACTGGCAGGTATAGTGTTCTCTAA
Gene >Agabi119p4|071590
ATGAGAGCCAAGCGCGCTAAACTAGAGGCATGGAAAAAAGAACGTGAAGCAAAGAAGGCTCTCGACGAGGCCAAG
GCCAAAGCCATGGCCCTCGCCGGGAGGGCTGCACCTGGTGAGTTTGACTCCTACTGCTGCGGAAGCGTGATTTCA
CAGTACTTGATTTAATGCCTTCCAGCCCCCGCAACCAAGACTGGCCAACTCAATCGCGCTGCGCTTGGAGGTTTA
GGTCTCAAGGGTCTTCCCCTAAAACCCGAGTTCTCGGTCGTCAAGGGTCTCGCTTCAATGGATGATTCTGTAGAA
ACAAAGCGCAAATTAGAGACTTTGGGGGATATGCCCGCCGTTGACATGAGCATGAAGGACGACGCGACTGTTGGT
GACCTAGAAGTAGATGATGATGATGAGGAAGCCAACAGAATGGACCAAGCATTGAAAGCCAAGGCGAAAGATACC
ATGGAAGTCGCTGAAGAGGACGAAGTCGATCCTCTCGATGCCTTCATGAGTGGGGTCAAAGAAGAGGTCAAGAAA
GTGAATATGGAAGACATGCAGAAAATGATAACTACCAATGGCCTTCAGTCTCGGGTTCGTTTGGATGACCAGATG
GGAGATGATGGCGTGGAGGCCGAAGTAGAGGGTACCGTTGATGAACTCGATGCAACGGAACTCAATCCGGAGGAT
ATCCTCGCTCTGGCCGCAAAAAAGGCGAAAAAAAAAGAGTTGGCCACAGTCGATCATTCACGTATTCATTATGAG
CCGTTCAGAAAGGAATTTTATGTCCCTCCACCTGATATCGCACATATGACTGACGATGAAGCTGAATTACTGCGC
CTTGAGCTGGACAGCATCAAAATCCGTGGTATTGATTGCCCTCGCCCCGTCACAAAATGGAGCCATTTTGGCATG
CCTGCCAACTGGTACGTATTTGACCATCTTCGTCCATTCCAGCTACTAATAGCCATAAATGCAGTCTCGACGTTA
TCAAGCGCTTGAACTATACTGCCCCGACATCTATCCAAGCCCAAGCCATACCTGCCATCATGTCTGGCCGAGACG
TTATTGGTGTAGCCAAGACTGGTTCCGGTAAAACAATCGCCTTTCTAATGCCCTTATTCCGTCACATCAAGGACC
AGCGTCCTCTCGAACAAATGGAAGGCCCCATTGCAGTCGTCATGACTCCGACACGCGAGTTGGCTGTCCAGATTC
ACAAAGATTGTAAGCCCTTTTTGAAAGTATTGGGTCTACGGGTGAGTGCTCAAAATTTCTACTGCTGTTGCGTTC
TTGAAACGACATTTGATAGGCTGTATGTGCATACGGCGGTTCGCCTATCAAGGATCAAATTGCAGAACTTAAAAA
GGGAGCTGAAATCATCGTCTGCACACCCGGTCGCATGATAGATTTGCTGACGGCCAATTCAGGTCGCGTCACCAA
TCTCAAACGGGTGACTTACGTTGTTCTTGACGAAGCTGACCGTATGTTCGACATGGGCTTCGAGCCACAGGTCAT
GAAAATTGTCAATAACACACGGCCTGATAGACAAACCGTCCTTTTCTCTGCAACCTTTCCCAAACAAATGGATTC
GCTTGCGCGGAAAATTTTACGAAAGCCCCTTGAAATTACTGTCGGTGGCAGATCAGTTGTTGCAGCCGAAATTGA
ACAAATTGTCGAGGTCCGTGCGGAGGACACTAAATTCAATCGGCTTCTGGAAATTCTTGGCCAAATGTATAACGA
GGATCCAGAGTGTAGAACCTTGATCTTTGTTGACCGACAAGAAGCTGCTGATAACCTTCTCCGAGAACTTATGCG
CAAAGGCTATCTCTGCATGTCGCTTCATGGGGGGAAGGATCAAGTAGACCGTGATCAAACTATCGCAGATTTCAA
GTCTGGCGTCGTCCCCATCGTTATCGCGACTTCAGTAGCTGCTCGTGGTCTGGACGTGAAGCAACTTAAATTGGT
CATTAATCATGATGCTCCGAACCACATGGAAGACTATGTTCATCGCGCTGGGCGTACGGGTCGCGCTGGTAATAA
GGGTACATGTGTTACATTTATTACACCCGAACAGGATCGCTATTCAGTTGATATTCATCGCGCTCTCAAGGCTAG
TAACGCCTCAATTCCGCAAGAATTAGAGGACTTGGCAAACGGTAAGTAGCATTACAATTCCAGAGTAACGTAATT
TCATCAACGTCTTCCTAGGTTTCCTCGAGAAAGTCAAATCAGGGAAAGCTCAGGCTGCTGGTTCCGGATTTGGTG
GAAAGGGCTTAGATCGACTAGATAAAGAACGTGATGCCCGCGAAAAGGCAGAAAGGAAAGCATATGGCGAGCCAA
CAGATGAAGACAAGCCTGAAGCAATCGCCCCCGCCGGGGCAGCGGCCAAAGTAGAAAACGCTGGTGTTGTTAGTA
ACGATGATATGAACTTTGGCAACTTCAAGGTCGAAATCAAGCGTGGTCCCGCACCAGATTCATCTAAAGGCCTTT
TGGGAGTCTCAGGAGCGGTCGCTGCTGCGCGTCGCCTTGCACATGCCAAGGAGGAAGAGAGAATACAGAGTCAGA
TGCGCGCGGCTGAAGAAGCTGCTGCTCGTGCAGGCAAAGATACTCCAGCTCATAAGCAAGCTTTGAATGTAGTGG
CGAAGTTGAATGCGCAGCTTAGAGCATCGAAATTGGTGTTACAGTCACAGTTACAAGCGGAGGAATCTGGGCGCA
AGATCAATCCCGATTCAACTGATTTCCATGCCATCATACCCATCAATGATTATCCTCAGAAAGCCCGTTGGCGTG
TTACCAACAAGGAGACCATGACCCAGGTGAGTACTCAATCGTCTTCAGCACGTCTAACATATCTGACACGTCTCT
TTTCTTCAGCTCATCGACATGACTGGTGCTTCAGTTACTAATAAAGGTACGTCCTTCACAACCTACGGTTCGGTG
TATCTGACTGAGCGTTCTCAAGGTATTTATTATGAAACTGGAAAAGAGCCACCAGCCGAGGGACCGCCCAAACTC
CATCTACTTATTGAATCAAATGAAGAATACAGGGTAAGCAGTAGTTCTCCCTTTAACAGAGCGATAACACTCAAA
GGACTCAATCAGGTTGAGCAAGCGGTACGCGAAATCAAGCGTCTACTCATAGAAGCGTCTGCTGCTGCCATACAG
GCAGAAATGCGGAACCCAACGGCAACTGGCAGGTATAGTGTTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail