Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071340
Gene name
Locationscaffold_04:1381318..1383184
Strand+
Gene length (bp)1866
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-15 121 194
PF13637 Ank_4 Ankyrin repeats (many copies) 6.4E-14 131 184
PF13637 Ank_4 Ankyrin repeats (many copies) 5.5E-05 169 204
PF13857 Ank_5 Ankyrin repeats (many copies) 1.0E-09 123 171
PF13857 Ank_5 Ankyrin repeats (many copies) 2.9E-09 155 204
PF00023 Ank Ankyrin repeat 1.7E-04 131 161
PF00023 Ank Ankyrin repeat 2.1E-07 164 195
PF13606 Ank_3 Ankyrin repeat 6.0E-04 131 156
PF13606 Ank_3 Ankyrin repeat 3.3E-05 164 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 9 200 5.0E-12
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 124 199 6.0E-12
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 124 199 6.0E-12
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 124 199 7.0E-12
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 124 199 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 9 200 5.0E-12
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 124 199 6.0E-12
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 124 199 6.0E-12
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 124 199 7.0E-12
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 124 199 7.0E-12
sp|Q04749|AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1 4 243 1.0E-11
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 124 205 4.0E-11
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 120 202 5.0E-11
sp|Q60772|CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus GN=Cdkn2c PE=1 SV=1 131 217 5.0E-11
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 124 205 1.0E-10
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 131 204 2.0E-10
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 131 206 2.0E-10
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 131 271 3.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 123 199 3.0E-10
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 36 200 3.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 123 199 3.0E-10
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 131 204 4.0E-10
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 131 204 4.0E-10
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 5 214 4.0E-10
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 123 215 5.0E-10
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 130 199 5.0E-10
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 5 214 6.0E-10
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 33 215 6.0E-10
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 131 198 7.0E-10
sp|Q86W74|ANR46_HUMAN Ankyrin repeat domain-containing protein 46 OS=Homo sapiens GN=ANKRD46 PE=1 SV=1 130 199 7.0E-10
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 130 206 7.0E-10
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 5 214 8.0E-10
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 130 206 8.0E-10
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 131 249 9.0E-10
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 130 206 9.0E-10
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 131 204 1.0E-09
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 123 217 1.0E-09
sp|Q6TNT2|ANR46_DANRE Ankyrin repeat domain-containing protein 46 OS=Danio rerio GN=ankrd46 PE=2 SV=1 130 191 1.0E-09
sp|Q3SX00|ANR46_BOVIN Ankyrin repeat domain-containing protein 46 OS=Bos taurus GN=ANKRD46 PE=2 SV=1 130 199 1.0E-09
sp|Q5R8C8|ANR46_PONAB Ankyrin repeat domain-containing protein 46 OS=Pongo abelii GN=ANKRD46 PE=2 SV=1 130 199 1.0E-09
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 131 204 1.0E-09
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 131 219 1.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 127 212 1.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 124 199 1.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 100 199 2.0E-09
sp|Q9SAR5|AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana GN=AKR2A PE=1 SV=2 125 218 2.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 124 199 2.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 115 242 2.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 131 204 2.0E-09
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 131 200 2.0E-09
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 127 239 2.0E-09
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 131 204 3.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 100 199 3.0E-09
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 127 204 3.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 131 204 3.0E-09
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 131 219 3.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 128 214 4.0E-09
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 128 204 4.0E-09
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 120 242 4.0E-09
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 130 206 4.0E-09
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 125 230 4.0E-09
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 130 217 4.0E-09
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 128 204 5.0E-09
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 127 192 5.0E-09
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 127 192 5.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 121 200 5.0E-09
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 131 219 5.0E-09
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 128 221 6.0E-09
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 130 217 6.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 120 242 6.0E-09
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 128 204 6.0E-09
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 131 208 6.0E-09
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 127 200 6.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 22 199 7.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 102 199 7.0E-09
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 42 200 7.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 5 204 8.0E-09
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 138 232 8.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 22 199 9.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 100 199 9.0E-09
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 130 217 9.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 102 199 9.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 131 215 1.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 124 212 1.0E-08
sp|Q9Z1P7|KANK3_MOUSE KN motif and ankyrin repeat domain-containing protein 3 OS=Mus musculus GN=Kank3 PE=1 SV=1 131 212 1.0E-08
sp|Q8BTZ5|ANR46_MOUSE Ankyrin repeat domain-containing protein 46 OS=Mus musculus GN=Ankrd46 PE=1 SV=1 130 199 1.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 132 204 1.0E-08
sp|P42773|CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens GN=CDKN2C PE=1 SV=1 125 212 1.0E-08
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 10 226 1.0E-08
sp|Q76K24|ANR46_RAT Ankyrin repeat domain-containing protein 46 OS=Rattus norvegicus GN=Ankrd46 PE=2 SV=1 130 199 1.0E-08
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 127 235 1.0E-08
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 128 221 1.0E-08
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 133 209 1.0E-08
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 125 215 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 128 227 2.0E-08
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 131 222 2.0E-08
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 132 217 2.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 123 186 2.0E-08
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 9 264 2.0E-08
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 130 197 2.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 128 199 2.0E-08
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 130 197 2.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 133 204 2.0E-08
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 118 197 2.0E-08
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 124 196 2.0E-08
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 125 200 2.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 123 196 2.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 120 199 3.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 127 200 3.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 2 215 3.0E-08
sp|Q29Q26|AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana GN=AKR2B PE=1 SV=1 125 218 3.0E-08
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 77 242 3.0E-08
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 131 224 3.0E-08
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 128 221 3.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 128 199 4.0E-08
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 133 204 4.0E-08
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 128 200 4.0E-08
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 125 200 4.0E-08
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 127 204 4.0E-08
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 130 214 4.0E-08
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 106 212 4.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 112 200 5.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 127 199 5.0E-08
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 131 212 5.0E-08
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 127 219 5.0E-08
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 41 272 5.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 112 199 6.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 112 199 6.0E-08
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 128 200 6.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 34 204 6.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 127 199 7.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 124 199 8.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 92 199 8.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 124 204 9.0E-08
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 122 216 9.0E-08
sp|Q8LSQ2|SR43C_ORYSJ Probable signal recognition particle 43 kDa protein, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0131900 PE=2 SV=1 125 199 9.0E-08
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 69 204 9.0E-08
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 128 230 1.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 14 197 1.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 10 199 1.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 10 199 1.0E-07
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 131 222 1.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 130 204 1.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 112 200 1.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 120 199 1.0E-07
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 133 204 1.0E-07
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 122 202 1.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 133 204 1.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 69 204 1.0E-07
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 110 200 1.0E-07
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 124 212 1.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 42 204 1.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 120 199 1.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 132 199 1.0E-07
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 130 197 1.0E-07
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 110 200 1.0E-07
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 91 239 1.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 124 212 1.0E-07
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 125 197 1.0E-07
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 125 216 1.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 124 199 1.0E-07
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 124 221 1.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 124 199 2.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 112 199 2.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 127 199 2.0E-07
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 128 204 2.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 131 200 2.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 133 204 2.0E-07
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 124 212 2.0E-07
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 51 200 2.0E-07
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 125 197 2.0E-07
sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 127 197 2.0E-07
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 133 214 2.0E-07
sp|Q9D119|PPR27_MOUSE Protein phosphatase 1 regulatory subunit 27 OS=Mus musculus GN=Ppp1r27 PE=2 SV=1 124 202 2.0E-07
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 127 194 2.0E-07
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 131 214 2.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 124 212 2.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 92 212 2.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 92 212 2.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 121 199 2.0E-07
sp|B4E2M5|ANR66_HUMAN Ankyrin repeat domain-containing protein 66 OS=Homo sapiens GN=ANKRD66 PE=2 SV=2 124 238 2.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 40 199 2.0E-07
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 113 191 2.0E-07
sp|Q9HLN1|Y196_THEAC Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 131 235 2.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 40 199 2.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 119 194 2.0E-07
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 131 221 2.0E-07
sp|A4II29|NRARP_XENTR Notch-regulated ankyrin repeat-containing protein OS=Xenopus tropicalis GN=nrarp PE=3 SV=1 130 186 2.0E-07
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 3 207 2.0E-07
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 133 214 2.0E-07
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 128 193 2.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 125 199 3.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 125 199 3.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1 199 3.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 120 197 3.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1 197 3.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 124 199 3.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 117 197 3.0E-07
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 40 199 3.0E-07
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 124 199 3.0E-07
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 124 199 3.0E-07
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 122 216 3.0E-07
sp|Q86WC6|PPR27_HUMAN Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens GN=PPP1R27 PE=1 SV=1 131 202 3.0E-07
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 133 214 3.0E-07
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 4 200 3.0E-07
sp|Q5U5A6|NRARP_XENLA Notch-regulated ankyrin repeat-containing protein OS=Xenopus laevis GN=nrarp PE=1 SV=1 130 186 3.0E-07
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 40 199 3.0E-07
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 130 198 3.0E-07
sp|Q7T3X9|NARPB_DANRE Notch-regulated ankyrin repeat-containing protein B OS=Danio rerio GN=nrarpb PE=2 SV=1 130 186 3.0E-07
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 128 218 3.0E-07
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 128 218 3.0E-07
sp|Q8CG79|ASPP2_MOUSE Apoptosis-stimulating of p53 protein 2 OS=Mus musculus GN=Tp53bp2 PE=1 SV=3 113 224 3.0E-07
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 128 218 3.0E-07
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 128 218 3.0E-07
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 123 185 3.0E-07
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 70 207 3.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 124 214 3.0E-07
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 128 218 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 117 212 4.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 130 199 4.0E-07
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 130 258 4.0E-07
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 131 200 4.0E-07
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 85 200 4.0E-07
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 3 207 4.0E-07
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 128 197 4.0E-07
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 124 218 4.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 69 217 4.0E-07
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 132 212 4.0E-07
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 131 222 4.0E-07
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 80 211 4.0E-07
sp|Q9XVN3|IASPP_CAEEL Apoptotic enhancer 1 protein OS=Caenorhabditis elegans GN=ape-1 PE=1 SV=1 115 187 4.0E-07
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 130 198 4.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 117 212 5.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 124 199 5.0E-07
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 69 204 5.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 69 217 5.0E-07
sp|Q13625|ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens GN=TP53BP2 PE=1 SV=2 113 224 5.0E-07
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 41 220 5.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 130 193 5.0E-07
sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=1 SV=1 127 197 5.0E-07
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 131 207 5.0E-07
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 127 189 5.0E-07
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 131 214 5.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 124 199 6.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 7 225 6.0E-07
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 130 193 6.0E-07
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 131 200 6.0E-07
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 131 200 6.0E-07
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 131 200 6.0E-07
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 131 200 6.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 131 200 6.0E-07
sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 131 204 6.0E-07
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 132 233 6.0E-07
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 81 204 7.0E-07
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 128 218 7.0E-07
sp|A2ARS0|ANR63_MOUSE Ankyrin repeat domain-containing protein 63 OS=Mus musculus GN=Ankrd63 PE=1 SV=1 72 206 7.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 130 214 8.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 131 212 9.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 124 199 9.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 131 212 9.0E-07
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 124 195 9.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 118 199 9.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 118 199 9.0E-07
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 124 214 9.0E-07
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 130 193 9.0E-07
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 8 187 9.0E-07
sp|Q9NXR5|ANR10_HUMAN Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 132 217 9.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 100 199 1.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 100 199 1.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 131 228 1.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 130 199 1.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 131 212 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 130 199 1.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 133 199 1.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 124 204 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 72 215 1.0E-06
sp|Q9HLN1|Y196_THEAC Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 128 229 1.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 10 199 1.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 135 200 1.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 135 200 1.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 35 196 1.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 130 212 1.0E-06
sp|C9JTQ0|ANR63_HUMAN Ankyrin repeat domain-containing protein 63 OS=Homo sapiens GN=ANKRD63 PE=3 SV=1 72 206 1.0E-06
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 18 214 1.0E-06
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 133 196 1.0E-06
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 145 197 1.0E-06
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 10 183 1.0E-06
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 131 214 1.0E-06
sp|Q810N6|ANR45_MOUSE Ankyrin repeat domain-containing protein 45 OS=Mus musculus GN=Ankrd45 PE=1 SV=1 121 211 1.0E-06
sp|Q7T3Y0|NARPA_DANRE Notch-regulated ankyrin repeat-containing protein A OS=Danio rerio GN=nrarpa PE=2 SV=1 130 187 1.0E-06
sp|Q8K3X6|ANS4B_MOUSE Ankyrin repeat and SAM domain-containing protein 4B OS=Mus musculus GN=Anks4b PE=1 SV=1 124 211 1.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 1 205 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 131 218 1.0E-06
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 131 200 1.0E-06
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 3 207 1.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 127 194 1.0E-06
sp|Q8N8V4|ANS4B_HUMAN Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens GN=ANKS4B PE=1 SV=2 124 206 1.0E-06
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 28 253 1.0E-06
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 136 222 1.0E-06
sp|Q9VSA4|TONSL_DROME Tonsoku-like protein OS=Drosophila melanogaster GN=CG7457 PE=1 SV=1 128 202 1.0E-06
sp|Q03017|CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster GN=cact PE=1 SV=2 42 218 1.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 131 214 1.0E-06
sp|Q6NY19|KANK3_HUMAN KN motif and ankyrin repeat domain-containing protein 3 OS=Homo sapiens GN=KANK3 PE=1 SV=1 131 232 1.0E-06
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 124 204 1.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 122 204 2.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 123 206 2.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 123 199 2.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 74 212 2.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 124 199 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 74 199 2.0E-06
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 130 194 2.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 124 204 2.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 21 199 2.0E-06
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 130 200 2.0E-06
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 35 196 2.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 42 252 2.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 42 252 2.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 123 187 2.0E-06
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 130 279 2.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 40 186 2.0E-06
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 10 229 2.0E-06
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 7 228 2.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 124 204 2.0E-06
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 145 197 2.0E-06
sp|P83757|CACT_DROYA NF-kappa-B inhibitor cactus OS=Drosophila yakuba GN=cact PE=3 SV=1 42 218 2.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 42 186 2.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 42 186 2.0E-06
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 3 204 2.0E-06
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 3 204 2.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 133 200 2.0E-06
sp|Q99LW0|ANR10_MOUSE Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 132 214 2.0E-06
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 135 226 2.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 124 214 2.0E-06
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 131 206 2.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 128 192 2.0E-06
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 128 197 2.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 124 199 3.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 128 242 3.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 130 204 3.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 130 204 3.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 131 215 3.0E-06
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 130 194 3.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 124 211 3.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 124 199 3.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 131 215 3.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 124 208 3.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 131 196 3.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 133 199 3.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 131 196 3.0E-06
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 124 214 3.0E-06
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 10 218 3.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 123 204 3.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 121 239 3.0E-06
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 117 212 3.0E-06
sp|Q5ZLC6|ANR10_CHICK Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 132 217 3.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 42 186 3.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 124 214 3.0E-06
sp|Q91ZA8|NRARP_MOUSE Notch-regulated ankyrin repeat-containing protein OS=Mus musculus GN=Nrarp PE=2 SV=1 130 187 3.0E-06
sp|Q7Z6K4|NRARP_HUMAN Notch-regulated ankyrin repeat-containing protein OS=Homo sapiens GN=NRARP PE=3 SV=1 130 187 3.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 124 199 4.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 124 199 4.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 130 204 4.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 130 204 4.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1 199 4.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 124 200 4.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 124 199 4.0E-06
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 124 195 4.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 133 212 4.0E-06
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 124 193 4.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 75 200 4.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 42 204 4.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 127 216 4.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 124 214 4.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 132 212 4.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 54 204 4.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 124 214 4.0E-06
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 130 206 4.0E-06
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 12 187 4.0E-06
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 28 253 4.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 2 233 4.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 124 214 4.0E-06
sp|Q5TZF3|ANR45_HUMAN Ankyrin repeat domain-containing protein 45 OS=Homo sapiens GN=ANKRD45 PE=1 SV=1 121 211 4.0E-06
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 130 194 4.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 124 199 5.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 123 207 5.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 35 196 5.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 124 214 5.0E-06
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 128 204 5.0E-06
sp|Q63369|NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 132 230 5.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 124 199 5.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 124 190 5.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 22 208 5.0E-06
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 125 197 5.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 132 212 5.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 132 212 5.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 131 207 5.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 124 214 5.0E-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 124 214 5.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 128 192 5.0E-06
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 124 199 5.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 128 185 5.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1 199 6.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 128 214 6.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 133 194 6.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 133 194 6.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 124 204 6.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 122 243 6.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 124 197 6.0E-06
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 124 190 6.0E-06
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 134 237 6.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 124 238 7.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 131 209 7.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 133 199 7.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 42 204 7.0E-06
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 124 190 7.0E-06
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 131 215 7.0E-06
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 94 212 8.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 124 204 8.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 10 199 8.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 124 214 8.0E-06
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 124 190 8.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 124 190 8.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 135 219 8.0E-06
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 132 204 8.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 5 192 9.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 124 204 9.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 42 232 9.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 131 193 9.0E-06
sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 39 221 9.0E-06
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 133 196 9.0E-06
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 135 204 9.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 74 212 1.0E-05
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 124 204 1.0E-05
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 131 214 1.0E-05
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 105 196 1.0E-05
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 73 214 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071340
MAEKDAPSRLRRAVKENNLFLVKRLVQRVDMRNPDPSSRRLTSLAWAALLANEETFEFLLVFGHDDEDISRDSEN
NTILMILADSGPPPQIYSSSASTLDFNSATLRMARLYYDRYQSSILNLLDWSNVQGRTALHLAAIKGNEDLVRMF
CELGADMNLPDKQGNTPLHYASAWGHVPIVQLLIERGCNYNSRNNEGFTASDYAYSFSTQEMQKTAEKQYELTKK
SRRAGLQNGRPLDFGTSPPINIPPSMRDQVPRMRSGSGTSHFFFSFPTFHGIRMATFSGSLASLNPVSALAPIAN
RVRTQDADARGKYMLRNRSGSSSTDNKSQSGSAFSNALAIHDELPTSSDRLHSGSMTPRRLRPSASAAQLRSRHD
SPAPGIRTRAGTNPMASTQLTRLSSITNSPFVPGRDAETYHGPPSQYARFPEPPPIQEDSSTPTAARRKAFQILS
KPLPPVDHSSNHRRGMSATAVRGPQ*
Coding >Agabi119p4|071340
ATGGCGGAAAAGGATGCTCCATCCCGGCTACGGCGTGCCGTCAAAGAAAATAACCTCTTTCTGGTCAAGAGGCTA
GTACAGAGAGTAGACATGCGCAATCCCGACCCGTCGTCTCGAAGATTAACGTCCCTTGCATGGGCGGCCCTCCTA
GCCAATGAGGAAACTTTTGAGTTTCTGCTTGTATTCGGCCACGACGACGAGGACATCAGCCGGGACTCCGAGAAT
AATACCATACTCATGATATTGGCTGATTCTGGCCCCCCTCCACAGATTTACAGCTCTTCTGCTTCGACACTTGAC
TTTAACAGTGCAACGCTACGCATGGCCCGTCTATATTATGATAGGTATCAGTCAAGTATCCTCAACCTTCTCGAT
TGGTCGAACGTGCAAGGCAGGACGGCACTACATCTTGCTGCAATCAAAGGAAATGAAGACCTCGTCCGCATGTTC
TGCGAGCTTGGTGCTGACATGAATCTACCTGACAAACAAGGAAACACACCACTGCATTATGCCAGTGCCTGGGGA
CACGTCCCTATCGTCCAGTTACTCATTGAGCGAGGGTGCAATTATAATTCACGCAACAACGAGGGTTTTACTGCC
TCCGATTATGCTTATTCCTTCAGTACCCAAGAAATGCAGAAAACGGCAGAAAAGCAATACGAACTTACCAAAAAG
TCTCGCCGTGCTGGGCTGCAAAACGGTCGACCACTGGATTTCGGGACATCACCTCCAATCAATATACCACCTAGC
ATGCGAGATCAAGTACCCAGGATGCGAAGTGGATCAGGCACCAGCCACTTCTTCTTCTCCTTCCCAACCTTCCAC
GGGATCCGCATGGCGACATTTTCTGGCTCGCTAGCTTCCTTGAACCCCGTGTCTGCTCTAGCCCCCATCGCTAAT
CGAGTGAGAACACAAGATGCGGATGCCCGAGGGAAATATATGCTTAGGAACAGAAGTGGAAGTTCCTCGACGGAC
AACAAATCGCAGTCTGGTTCTGCCTTCTCCAATGCATTGGCGATCCATGATGAATTGCCTACTAGTAGCGATCGC
TTGCATAGCGGTAGTATGACCCCGCGGCGACTCCGACCATCTGCATCTGCCGCACAGTTACGATCAAGGCACGAT
TCACCAGCACCCGGAATTCGAACAAGGGCGGGAACCAATCCCATGGCCAGCACACAGCTGACCCGCTTATCTTCG
ATCACCAACTCGCCCTTCGTTCCGGGTAGAGATGCCGAGACTTACCATGGGCCGCCGAGCCAGTATGCGCGGTTC
CCGGAACCACCACCAATTCAGGAAGATTCCAGTACGCCAACGGCGGCACGTCGGAAGGCGTTTCAAATTCTATCC
AAACCGCTACCCCCCGTGGACCATTCGTCCAATCACCGACGTGGCATGTCTGCCACTGCTGTACGTGGGCCCCAG
TAG
Transcript >Agabi119p4|071340
ATGGCGGAAAAGGATGCTCCATCCCGGCTACGGCGTGCCGTCAAAGAAAATAACCTCTTTCTGGTCAAGAGGCTA
GTACAGAGAGTAGACATGCGCAATCCCGACCCGTCGTCTCGAAGATTAACGTCCCTTGCATGGGCGGCCCTCCTA
GCCAATGAGGAAACTTTTGAGTTTCTGCTTGTATTCGGCCACGACGACGAGGACATCAGCCGGGACTCCGAGAAT
AATACCATACTCATGATATTGGCTGATTCTGGCCCCCCTCCACAGATTTACAGCTCTTCTGCTTCGACACTTGAC
TTTAACAGTGCAACGCTACGCATGGCCCGTCTATATTATGATAGGTATCAGTCAAGTATCCTCAACCTTCTCGAT
TGGTCGAACGTGCAAGGCAGGACGGCACTACATCTTGCTGCAATCAAAGGAAATGAAGACCTCGTCCGCATGTTC
TGCGAGCTTGGTGCTGACATGAATCTACCTGACAAACAAGGAAACACACCACTGCATTATGCCAGTGCCTGGGGA
CACGTCCCTATCGTCCAGTTACTCATTGAGCGAGGGTGCAATTATAATTCACGCAACAACGAGGGTTTTACTGCC
TCCGATTATGCTTATTCCTTCAGTACCCAAGAAATGCAGAAAACGGCAGAAAAGCAATACGAACTTACCAAAAAG
TCTCGCCGTGCTGGGCTGCAAAACGGTCGACCACTGGATTTCGGGACATCACCTCCAATCAATATACCACCTAGC
ATGCGAGATCAAGTACCCAGGATGCGAAGTGGATCAGGCACCAGCCACTTCTTCTTCTCCTTCCCAACCTTCCAC
GGGATCCGCATGGCGACATTTTCTGGCTCGCTAGCTTCCTTGAACCCCGTGTCTGCTCTAGCCCCCATCGCTAAT
CGAGTGAGAACACAAGATGCGGATGCCCGAGGGAAATATATGCTTAGGAACAGAAGTGGAAGTTCCTCGACGGAC
AACAAATCGCAGTCTGGTTCTGCCTTCTCCAATGCATTGGCGATCCATGATGAATTGCCTACTAGTAGCGATCGC
TTGCATAGCGGTAGTATGACCCCGCGGCGACTCCGACCATCTGCATCTGCCGCACAGTTACGATCAAGGCACGAT
TCACCAGCACCCGGAATTCGAACAAGGGCGGGAACCAATCCCATGGCCAGCACACAGCTGACCCGCTTATCTTCG
ATCACCAACTCGCCCTTCGTTCCGGGTAGAGATGCCGAGACTTACCATGGGCCGCCGAGCCAGTATGCGCGGTTC
CCGGAACCACCACCAATTCAGGAAGATTCCAGTACGCCAACGGCGGCACGTCGGAAGGCGTTTCAAATTCTATCC
AAACCGCTACCCCCCGTGGACCATTCGTCCAATCACCGACGTGGCATGTCTGCCACTGCTGTACGTGGGCCCCAG
TAG
Gene >Agabi119p4|071340
ATGGCGGAAAAGGATGCTCCATCCCGGCTACGGCGTGCCGTCAAAGGTATGTCCATATTTCATTCCTATTCTCTC
CCGATGAAAAGTAAATGACCACCGCCACAGAAAATAACCTCTTTCTGGTCAAGAGGCTAGTACAGAGAGTAGACA
TGCGCAATCCCGACCCGTCGTCTCGAAGATTAACGTCCCTTGCATGGGCGGCCCTCCTAGCCAATGAGGAAACTT
TTGAGTTTCTGCTTGTATTCGGCCACGACGACGAGGACATCAGCCGGGTTCGACTTGCTGTCTATCCTGTTGTTA
GCGATCGACTGACGCTCTCGATATCCATAGGACTCCGAGAATAATACCATACTCATGATATTGGCTGATTCTGGC
CCCCCTCCACAGATTTACAGCTCTTCTGCTTCGACACTTGACTTTAACAGTGCAACGCTACGCATGGCCCGTCTA
TATTATGATAGGTATCAGTCAAGTATCCTCAACCTTCTCGATTGGTCGAACGTGCAAGGCAGGACGGCACTACAT
CTTGCTGCAATCAAAGGAAATGAAGACCTCGTCCGCGTATGTATATATGGCTTTCAGTAGAGAAGAGTTAACCAA
CTACACCCTCGTTAGATGTTCTGCGAGCTTGGTGCTGACATGAATCTACCTGACAAACAAGGAAACACACCACTG
CATTAGTAAGTTGAATCCTTGCAGCTGTATGGATTGTATTGGAATGAAATTGTTTAGTGCCAGTGCCTGGGGACA
CGTCCCTGTGAGTCTTGACGCTGGGTACGCTGTTCAATGAAACCCATGCATCACTTCAGATCGTCCAGTTACTCA
TTGAGCGAGGGTGCAATTATAATTCACGCAACAACGAGGGTTTTACTGCCTCCGATTATGCTTATTCGTATGTTG
ACTTGTTCTTTGCCTATCCCTTTGTCAAACTTCTTCGTGAATAGCTTCAGTACCCAAGAAATGCAGAAAACGGCA
GAAAAGCAATACGAACTTACCAAAAAGTCTCGCCGTGCTGGGCTGCAAAACGGTCGACCACTGGATTTCGGGACA
TCACCTCCAATCAATATACCACCTAGCATGCGAGATCAAGTACCCAGGATGCGAAGTGGATCAGGCACCAGCCGT
ACGACCGCTACCTCCGATAGTGGAGACTTGGATGGCCACGGACAGACTTCTTCTTCTCCTTCCCAACCTTCCACG
GGATCCGGTTCGTTTTTCTACAGTCCAAAAACATCCACCAACCACACTGCTCACGTAGCGTCCGCGAGCAGCATG
GCGACATTTTCTGGCTCGCTAGCTTCCTTGAACCCCGTGTCTGCTCTAGCCCCCATCGCTAATCGAGTGAGAACA
CAAGATGCGGATGCCCGAGGGAAATATATGCTTAGGAACAGAAGTGGAAGTTCCTCGACGGACAACAAATCGCAG
TCTGGTTCTGCCTTCTCCAATGCATTGGCGATCCATGATGAATTGCCTACTAGTAGCGATCGCTTGCATAGCGGT
AGTATGACCCCGCGGCGACTCCGACCATCTGCATCTGCCGCACAGTTACGATCAAGGCACGATTCACCAGCACCC
GGAATTCGAACAAGGGCGGGAACCAATCCCATGGCCAGCACACAGCTGACCCGCTTATCTTCGATCACCAACTCG
CCCTTCGTTCCGGGTAGAGATGCCGAGACTTACCATGGGCCGCCGAGCCAGTATGCGCGGTTCCCGGAACCACCA
CCAATTCAGGAAGATTCCAGTACGCCAACGGCGGCACGTCGGAAGGCGTTTCAAATTCTATCCAAACCGCTACCC
CCCGTGGACCATTCGTCCAATCACCGACGTGGCATGTCTGCCACTGCTGTACGTGGGCCCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail