Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071300
Gene name
Locationscaffold_04:1369764..1372977
Strand+
Gene length (bp)3213
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 7.2E-79 103 333
PF16335 DUF4965 Domain of unknown function (DUF4965) 1.3E-75 338 515
PF08760 DUF1793 Domain of unknown function (DUF1793) 1.1E-68 521 687
PF16334 DUF4964 Domain of unknown function (DUF4964) 5.3E-09 21 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 687 0.0E+00
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 22 694 1.0E-121

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071300
MHWLLYLLSCVGTIHAAVTWNAEPFNPPSFPLAVRSPYLSAWLPQGSGAALNDVWPTFWTGQTLGWAGFVKVDNN
AYSFLGTPNVPNAAFSKAVQKSSKFTATQTTFVLSAGPVDLTITFLSPVEATDLLKQSTPFAYMAVSASSTDGAA
HRVQVYSDISAEWVSGNNGLAANWTTSTGSVITHQVQLVNQAVLSEVNDHTQYGSAFYSTLSTSGVTWQSGEDIS
VRAQFINNGRLPNTRDTNFRAINDAWPVFAISHDLGNVRAATTPVVTSVGHIRDPALRYIVAGGGTQLRSSYFLS
RFSRPADLISEFLNDFPEALDRSNALDAKVNSDASRISSDYAAIVALSVRQAIAATEITISRNSNGSFNVNDIII
FMKEISSNGNINTVDVIFPTWPLLLYLNPQLGKFLLEGLFRYQATGQYPNKYSIHDLGASYPNALGHNDGRDERM
PVEESGNMIIMSLSYVQRTNDQSQIRQYSALLDQWAQFLIEDSLIPENQISTDDFAGPLANQTNLAIKGIVGIKA
MSEIASLLGDQAKSNNYSAIAADYVTQWRGLARSTRGPHLTLSYNDADSWGLTYNLFGDKLLGLNLFPQDVYTTQ
TAWYKTVARPFGVPLDTRHTYTKTDWEIWTASIATDTSVRDLLISSVRKYASSGLASQPFGDWYETTNGAPQGFR
ARPVVGGHLALVSQVSSVCLLSYSST*
Coding >Agabi119p4|071300
ATGCACTGGCTGTTGTACTTGTTATCATGCGTTGGCACTATTCATGCTGCAGTGACTTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTCCCTCTGGCAGTCAGATCACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGCGCCGCT
TTGAATGATGTTTGGCCAACATTTTGGACTGGACAGACTCTTGGTTGGGCCGGCTTCGTCAAAGTGGATAATAAT
GCTTATAGCTTCCTCGGTACCCCCAATGTTCCCAATGCCGCCTTCTCTAAGGCCGTGCAGAAGAGCTCCAAGTTC
ACTGCTACCCAAACCACCTTTGTTCTCTCCGCTGGCCCTGTGGATCTCACCATCACTTTTTTAAGTCCTGTCGAG
GCGACGGACCTTTTAAAACAATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCT
CACCGCGTTCAGGTATACTCAGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACG
ACATCAACTGGATCCGTGATTACCCATCAAGTGCAACTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCAC
ACGCAATACGGATCCGCCTTTTACTCGACTCTCTCGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGACATTTCG
GTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTAATGATGCT
TGGCCTGTTTTCGCGATATCCCATGACCTCGGAAATGTGAGGGCAGCCACCACACCTGTCGTCACCTCTGTTGGC
CATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTTCCTCAGC
CGGTTCTCTAGGCCGGCAGATCTGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCC
CTTGACGCCAAAGTAAACAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGA
CAGGCTATAGCCGCAACCGAGATTACCATTTCTCGGAACAGCAACGGGTCATTCAACGTAAACGATATCATTATA
TTCATGAAAGAGATTTCAAGTAATGGAAACATCAACACTGTCGATGTGATCTTTCCTACTTGGCCACTTCTATTA
TATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGTATCAGGCCACTGGTCAATACCCCAAT
AAATACAGTATCCATGACCTTGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATG
CCTGTTGAAGAAAGCGGGAACATGATCATTATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATC
CGGCAATATTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGATTCCCTCATTCCGGAAAATCAGATC
AGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATCAAGGGAATAGTCGGTATTAAAGCA
ATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAAAGCAATAACTATTCTGCCATCGCTGCTGATTACGTC
ACTCAATGGCGCGGTCTCGCAAGGTCGACCAGAGGTCCACATTTGACGCTCTCGTATAATGATGCGGACAGCTGG
GGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTCAACTTATTCCCTCAAGACGTCTATACAACACAA
ACGGCATGGTACAAAACTGTAGCCCGACCATTCGGCGTCCCCCTTGATACACGTCACACGTACACCAAAACAGAC
TGGGAAATTTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATAC
GCATCAAGCGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACGAATGGTGCTCCACAGGGATTCCGT
GCCCGCCCGGTAGTCGGAGGTCATCTCGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCG
ACGTAA
Transcript >Agabi119p4|071300
ATGCACTGGCTGTTGTACTTGTTATCATGCGTTGGCACTATTCATGCTGCAGTGACTTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTCCCTCTGGCAGTCAGATCACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGCGCCGCT
TTGAATGATGTTTGGCCAACATTTTGGACTGGACAGACTCTTGGTTGGGCCGGCTTCGTCAAAGTGGATAATAAT
GCTTATAGCTTCCTCGGTACCCCCAATGTTCCCAATGCCGCCTTCTCTAAGGCCGTGCAGAAGAGCTCCAAGTTC
ACTGCTACCCAAACCACCTTTGTTCTCTCCGCTGGCCCTGTGGATCTCACCATCACTTTTTTAAGTCCTGTCGAG
GCGACGGACCTTTTAAAACAATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCT
CACCGCGTTCAGGTATACTCAGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACG
ACATCAACTGGATCCGTGATTACCCATCAAGTGCAACTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCAC
ACGCAATACGGATCCGCCTTTTACTCGACTCTCTCGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGACATTTCG
GTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTAATGATGCT
TGGCCTGTTTTCGCGATATCCCATGACCTCGGAAATGTGAGGGCAGCCACCACACCTGTCGTCACCTCTGTTGGC
CATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTTCCTCAGC
CGGTTCTCTAGGCCGGCAGATCTGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCC
CTTGACGCCAAAGTAAACAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGA
CAGGCTATAGCCGCAACCGAGATTACCATTTCTCGGAACAGCAACGGGTCATTCAACGTAAACGATATCATTATA
TTCATGAAAGAGATTTCAAGTAATGGAAACATCAACACTGTCGATGTGATCTTTCCTACTTGGCCACTTCTATTA
TATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGTATCAGGCCACTGGTCAATACCCCAAT
AAATACAGTATCCATGACCTTGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATG
CCTGTTGAAGAAAGCGGGAACATGATCATTATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATC
CGGCAATATTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGATTCCCTCATTCCGGAAAATCAGATC
AGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATCAAGGGAATAGTCGGTATTAAAGCA
ATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAAAGCAATAACTATTCTGCCATCGCTGCTGATTACGTC
ACTCAATGGCGCGGTCTCGCAAGGTCGACCAGAGGTCCACATTTGACGCTCTCGTATAATGATGCGGACAGCTGG
GGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTCAACTTATTCCCTCAAGACGTCTATACAACACAA
ACGGCATGGTACAAAACTGTAGCCCGACCATTCGGCGTCCCCCTTGATACACGTCACACGTACACCAAAACAGAC
TGGGAAATTTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATAC
GCATCAAGCGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACGAATGGTGCTCCACAGGGATTCCGT
GCCCGCCCGGTAGTCGGAGGTCATCTCGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCG
ACGTAA
Gene >Agabi119p4|071300
ATGCACTGGCTGTTGTACTTGTTATCATGCGTTGGCACTATTCATGCTGCAGTGACTTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTCCCTCTGGCAGTCAGATCACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGTACGTGA
ATGCTCAATATTCTCAAGCGTATACTTACTGTCGAATCTAGGCGCCGCTTTGAATGATGTTTGGCCAACATTTTG
GACTGGACAGGTGGGTGAAGCAGTCTGTCTACGAGAGAGATACGTTGCTATATTCTATTAGACTCTTGGTTGGGC
CGGCTTCGTCAAAGTGGATAATAATGCTTATAGCTTCCTCGGTACCCCCAATGTTCCCAATGCCGCCTTCTCTAA
GGCCGTGCAGAAGAGCTCCAAGGTGATCGGTATAATTTTAGGCAACACTTTTCTCCCGTAACTCACCACTTCCAC
AGTTCACTGCTACCCAAACCACCTTTGTTCTCTCCGCTGGCCCTGTGGATCTCACCATCACTTTTTTAAGTCCTG
TCGAGGTGAATAATTTGATTTTCTCTTGTATCAAACGTGTCTAATCGTCATCTAGGCGACGGACCTTTTAAAACA
ATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCTCACCGCGTTCAGGTATACTC
AGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACGACATCAACTGGATCCGTGAT
TACCCATCAAGTGCAACTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCACACGCAATGTATGATTCTTTC
GCCTAGGCGTCCTTCAAGTAATACTAATACTCGTAGACGGATCCGCCTTTTACTCGACTCTCTCGGTAGGTGTAT
CGAATCTACAGATTGACGTATGCTGATTCCCTCCTGTCCAAAGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGA
CATTTCGGTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTAA
TGATGCTTGGCCTGTTTTCGCGATATCCCATGACCTCGGAAATGTGAGGGCAGCCACCACACCTGTCGTCACCTC
TGTTGGCCATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTT
CCTCAGCCGGTTCTCTAGGCCGGCAGATCTGGTAAGTACTACCTGTACAATGTAGATCTGCCCTTCATACCCGGT
TTGGTAGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCCCTTGACGCCAAAGTAAA
CAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGACAGGCTATAGCCGCAAC
CGAGATTACCATTTCTCGGAACAGCAACGGGTCATTCAACGTAAACGATATCATTATATTCATGAAAGGTCAGTA
TCAATGCTTAAAATGCCTTTATCCAGTTTTGTTGATCCCAAATATTTAGAGATTTCAAGTAATGGAGTACGAATC
AATATTCCCATCAAGTTGACAGGCTACAGCTAACCCCACTTAACTACGCTTAGAACATCAACACTGTCGATGTGA
TCTTTCCTACTTGGCCACTTCTATTATATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGT
ATCAGGCCACTGGTCAATACCCCAATAAATACAGTATCCATGACCTTGGTTGGCTTTTCCTCTCTCCCTCTCTTC
CACAGACTGACATTACACAGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATGCC
TGTTGAAGGTCCGTCCTCCCGGCGCTCCGAATATACTGATCTCATTTCCGAGTAGAAAGCGGGAACATGATCATT
ATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATCCGGCAATATGTAGGTGACCTCAAATTTTTC
GCTCTTCTCACTTGTGATTCACAATCTCTCTAGTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGAT
TCCCTCATTCCGGAAAATCAGATCAGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATC
AAGGGAATAGTCGGTATTAAAGCAATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAAAGCAATAACTAT
TCTGTACGTGTACCGAAAGGTTACTTTGCTAAACCGGGGTTTTGACCAACGGTTCTGTTCACAGGCCATCGCTGC
TGATTACGTCACTCAATGGCGCGGTCTCGCAAGGTCGACCAGAGGTCCACATTTGACGCTCTCGGTATGAAGTCC
TATCCTTATTTATCCTAAAATTGACGTTTGTCCAGTATAATGATGCGGACAGGTATGTTGAGTTTATTTGGCTGC
CAAAGCCACTTCTGATAGTCTCATTTCAGCTGGGGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTC
AACTTATTCCCTCAAGACGTCTATACAACACGTGAGTCGAGCCCTCATACTTTACTATCCGCGATTGACGTCTTT
TTAGAAACGGCATGGTACAAAACTGTAGCCCGTACGTAAGCGCATCTACTCTTGTAAGACATAAACTAACTTGAG
TTAGGACCATTCGGCGTCCCCCTTGATACACGGTAAGTTTATTCGACATTCGTCTTGTGATACAATGTCCTGAGC
GGCATAAATTTGTAGTCACACGTACACCAAAACAGGTACGCCGGTCTCTGCATAGGCCAACCCAAGTCATTACCA
TTGCATTGTCTGACTAATTTTTCGTTGTCCTCATCGTTGTGTGTCGAATGAATACCATATACTGACTAGACTGGG
AAATTTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATACGCAT
CAAGCGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACGAATGGTGCTCCACAGGGATTCCGTGCCC
GCCCGGTAGTCGGAGGTCATCTCGGTAAGTGTGGATGTAATGTAATCATGTCCTCGATGACTGACCGTCTGTTCT
GATGCTTCAGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail