Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071260
Gene name
Locationscaffold_04:1361175..1363863
Strand+
Gene length (bp)2688
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01717 Meth_synt_2 Cobalamin-independent synthase, Catalytic domain 2.4E-145 436 758
PF08267 Meth_synt_1 Cobalamin-independent synthase, N-terminal domain 1.3E-108 4 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT19|METE_SCHPO Probable 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met26 PE=1 SV=1 1 765 0.0E+00
sp|P82610|METE_CANAL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET6 PE=1 SV=2 1 764 0.0E+00
sp|Q87BY8|METE_XYLFT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B2I621|METE_XYLF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M23) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q9PB72|METE_XYLFA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metE PE=3 SV=1 1 761 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT19|METE_SCHPO Probable 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met26 PE=1 SV=1 1 765 0.0E+00
sp|P82610|METE_CANAL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET6 PE=1 SV=2 1 764 0.0E+00
sp|Q87BY8|METE_XYLFT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B2I621|METE_XYLF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M23) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q9PB72|METE_XYLFA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B0U3F5|METE_XYLFM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M12) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|P05694|METE_YEAST 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET6 PE=1 SV=4 1 764 0.0E+00
sp|Q11PV4|METE_CYTH3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A5FJR8|METE_FLAJ1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=metE PE=3 SV=1 7 762 0.0E+00
sp|Q9AAW1|METE_CAUCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|Q9AMV8|METE_BRADU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metE PE=3 SV=2 5 758 0.0E+00
sp|Q11EU7|METE_CHESB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chelativorans sp. (strain BNC1) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q2KYF3|METE_BORA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella avium (strain 197N) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q98A73|METE_RHILO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metE PE=3 SV=1 5 763 0.0E+00
sp|Q6N765|METE_RHOPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|A7HQP6|METE_PARL1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|B3QGC4|METE_RHOPT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q7W791|METE_BORPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metE PE=3 SV=2 1 758 0.0E+00
sp|Q7WKM7|METE_BORBR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q7VVU3|METE_BORPE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q3SGL1|METE_THIDA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metE PE=3 SV=1 1 764 0.0E+00
sp|A4XSY1|METE_PSEMY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A1TYT7|METE_MARHV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q7MZ74|METE_PHOLL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metE PE=3 SV=1 3 763 0.0E+00
sp|Q2SMS4|METE_HAHCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q54X49|METE_DICDI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Dictyostelium discoideum GN=metE PE=1 SV=1 1 765 0.0E+00
sp|Q2S338|METE_SALRD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|P45331|METE_HAEIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q1R4A4|METE_ECOUT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7MH94|METE_ECO45 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q8Z3B6|METE_SALTI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella typhi GN=metE PE=3 SV=3 2 762 0.0E+00
sp|B1LM00|METE_ECOSM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7NV51|METE_ECO7I 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A4TR46|METE_YERPP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q1CNC1|METE_YERPN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8ZAL3|METE_YERPE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q1CBG7|METE_YERPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q9JZQ2|METE_NEIMB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metE PE=1 SV=1 8 754 0.0E+00
sp|Q0TAP6|METE_ECOL5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A1AHZ7|METE_ECOK1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O1:K1 / APEC GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q32A07|METE_SHIDS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q31UF9|METE_SHIBS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B2TVH5|METE_SHIB3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q9L6N1|METE_SALTY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metE PE=3 SV=3 2 762 0.0E+00
sp|B4TBQ7|METE_SALHS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella heidelberg (strain SL476) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5F863|METE_NEIG1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|B5XYJ1|METE_KLEP3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B7LU25|METE_ESCF3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7NFD2|METE_ECOLU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q3YVD7|METE_SHISS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella sonnei (strain Ss046) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5FNW1|METE_SALDC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A1KTL3|METE_NEIMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|B6I4H1|METE_ECOSE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain SE11) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B1IW76|METE_ECOLC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7M634|METE_ECO8A 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5QW68|METE_SALEP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q9JUT6|METE_NEIMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|A8A6T6|METE_ECOHS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q66FT7|METE_YERPS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8FBM1|METE_ECOL6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metE PE=3 SV=3 2 758 0.0E+00
sp|A7ZU36|METE_ECO24 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B4TNX3|METE_SALSV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A9MY90|METE_SALPB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B5EZU1|METE_SALA4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella agona (strain SL483) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A4VNE5|METE_PSEU5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|A6TGK9|METE_KLEP7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|Q83IW0|METE_SHIFL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella flexneri GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q57HP2|METE_SALCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A4WFZ2|METE_ENT38 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Enterobacter sp. (strain 638) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|P25665|METE_ECOLI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain K12) GN=metE PE=1 SV=6 2 758 0.0E+00
sp|B1XAJ3|METE_ECODH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q0SZ21|METE_SHIF8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5RFN3|METE_SALG2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A9MIY8|METE_SALAR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A0B2Z3|METE_BURCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q1BQX8|METE_BURCA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A7FDD3|METE_YERP3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q3SNK1|METE_NITWN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q8X8L5|METE_ECO57 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O157:H7 GN=metE PE=3 SV=3 2 758 0.0E+00
sp|A9M4E3|METE_NEIM0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|Q1QZS5|METE_CHRSD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B4SZ67|METE_SALNS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella newport (strain SL254) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B5YY78|METE_ECO5E 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B1K5S8|METE_BURCC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q4KE22|METE_PSEF5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A9IKD8|METE_BORPD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q39AN3|METE_BURL3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q02L76|METE_PSEAB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A8ACX7|METE_CITK8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|P57703|METE_PSEAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B5BIX4|METE_SALPK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5PKP9|METE_SALPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B7VAU6|METE_PSEA8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B4EWC2|METE_PROMH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Proteus mirabilis (strain HI4320) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|B0UU16|METE_HISS2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Histophilus somni (strain 2336) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|O50008|METE1_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Arabidopsis thaliana GN=MS1 PE=1 SV=1 4 765 0.0E+00
sp|A1JIE5|METE_YERE8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B1J2V4|METE_PSEPW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas putida (strain W619) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|B1Z0R8|METE_BURA4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B5ELU7|METE_ACIF5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|B7J432|METE_ACIF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|B4EJ37|METE_BURCJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|B2JNZ4|METE_BURP8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q0B6M7|METE_BURCM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q82UP6|METE_NITEU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|P93263|METE_MESCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1 4 765 0.0E+00
sp|Q9F187|METE_CUPNE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cupriavidus necator GN=metE PE=3 SV=1 1 758 0.0E+00
sp|A3N1F9|METE_ACTP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q1I4X3|METE_PSEE4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas entomophila (strain L48) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q0K0V6|METE_CUPNH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|A5UBH4|METE_HAEIE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittEE) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A5UFD9|METE_HAEIG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittGG) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q9SRV5|METE2_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Arabidopsis thaliana GN=MS2 PE=1 SV=1 4 761 0.0E+00
sp|Q0I3P2|METE_HAES1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A4JJS1|METE_BURVG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B0BQ96|METE_ACTPJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B3GY43|METE_ACTP7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A6V1K5|METE_PSEA7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=metE PE=3 SV=1 1 747 0.0E+00
sp|A8G8B2|METE_SERP5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Serratia proteamaculans (strain 568) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|P57843|METE_PASMU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pasteurella multocida (strain Pm70) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q42699|METE_CATRO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1 4 765 0.0E+00
sp|A7MQM1|METE_CROS8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q83A62|METE_COXBU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A9KDA0|METE_COXBN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q6DAS2|METE_PECAS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q0VR89|METE_ALCBS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metE PE=3 SV=1 7 762 0.0E+00
sp|B6J6H8|METE_COXB1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q13MI3|METE_BURXL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia xenovorans (strain LB400) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|B5FFR4|METE_VIBFM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain MJ11) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|B2VI65|METE_ERWT9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A9N9C7|METE_COXBR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q5E430|METE_VIBF1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|Q3A7E2|METE_PELCD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q2NWV8|METE_SODGM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A1AXN4|METE_RUTMC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B6J3R8|METE_COXB2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q21N29|METE_SACD2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|Q87XJ9|METE_PSESM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q0WNZ5|METE3_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=MS3 PE=1 SV=1 4 761 0.0E+00
sp|Q2QLY4|METE2_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os12g0624000 PE=2 SV=1 4 765 0.0E+00
sp|Q3JAD5|METE_NITOC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q8KA71|METE_BUCAP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q2QLY5|METE1_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os12g0623900 PE=2 SV=1 4 765 0.0E+00
sp|Q93J59|METE_STRCO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|B1VV57|METE_STRGG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q725Q3|METE_DESVH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=metE PE=3 SV=1 7 761 0.0E+00
sp|Q89B24|METE_BUCBP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q1LU68|METE_BAUCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q42662|METE_PLESU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Plectranthus scutellarioides GN=MET PE=1 SV=2 4 765 0.0E+00
sp|B2TBS1|METE_BURPP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|A4SNB5|METE_AERS4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Aeromonas salmonicida (strain A449) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q8XS05|METE_RALSO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q8CWK1|METE_VIBVU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q7NS23|METE_CHRVO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q491V4|METE_BLOPB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|Q0A6U0|METE_ALKEH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q6LSD6|METE_PHOPR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Photobacterium profundum GN=metE PE=3 SV=1 3 764 0.0E+00
sp|P57142|METE_BUCAI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q7MJM6|METE_VIBVY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q058E7|METE_BUCCC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=metE PE=3 SV=1 4 764 0.0E+00
sp|Q0S6X7|METE_RHOJR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodococcus jostii (strain RHA1) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|B2UJ81|METE_RALPJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia pickettii (strain 12J) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q82LG4|METE_STRAW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=metE PE=3 SV=1 5 765 0.0E+00
sp|Q73WJ9|METE_MYCPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q9KRD8|METE_VIBCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metE PE=3 SV=1 1 764 0.0E+00
sp|Q8EIM0|METE_SHEON 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|A0QC69|METE_MYCA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium avium (strain 104) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A1T007|METE_PSYIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Psychromonas ingrahamii (strain 37) GN=metE PE=3 SV=1 7 761 0.0E+00
sp|Q605M0|METE_METCA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|A2RKK4|METE_LACLM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q87NA1|METE_VIBPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q9CG55|METE_LACLA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|A7MRX1|METE_VIBCB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q02YT3|METE_LACLS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q8KRG6|METE_VIBHA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio harveyi GN=metE PE=3 SV=1 4 758 0.0E+00
sp|P9WK07|METE_MYCTU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metE PE=1 SV=1 4 761 0.0E+00
sp|P9WK06|METE_MYCTO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A5U1I0|METE_MYCTA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A1KHS4|METE_MYCBP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|P65341|METE_MYCBO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A1A1F4|METE_BIFAA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|B8DUK6|METE_BIFA0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|O05564|METE_MYCLE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium leprae (strain TN) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q7VRI8|METE_BLOFL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia floridanus GN=metE PE=3 SV=1 2 763 0.0E+00
sp|B7GRV8|METE_BIFLS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|A4J5C3|METE_DESRM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=metE PE=3 SV=1 6 761 0.0E+00
sp|A5G0M4|METE_ACICJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|A3CL11|METE_STRSV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus sanguinis (strain SK36) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q8G651|METE_BIFLO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|B3DS65|METE_BIFLD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|A4VXA1|METE_STRSY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A1V6R3|METE_BURMS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain SAVP1) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q62LZ2|METE_BURMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A2S4V8|METE_BURM9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3MHJ9|METE_BURM7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q3JPU6|METE_BURP1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3NY08|METE_BURP0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B8DMM2|METE_DESVM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|A3NC70|METE_BURP6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 668) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q63RX6|METE_BURPS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A8AV19|METE_STRGC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q2SY55|METE_BURTA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B5E298|METE_STRP4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B5YJD3|METE_THEYD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q97S31|METE_STRPN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B1IAA7|METE_STRPI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q8DQT2|METE_STRR6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metE PE=3 SV=2 4 762 0.0E+00
sp|Q04LT6|METE_STRP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|A8FCD2|METE_BACP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|P80877|METE_BACSU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus subtilis (strain 168) GN=metE PE=1 SV=4 2 761 0.0E+00
sp|A9VFA6|METE_BACWK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q5HTR3|METE_CAMJR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni (strain RM1221) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q8Y6K3|METE_LISMO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|A7H2H6|METE_CAMJD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A8FMQ7|METE_CAMJ8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|C1EQ20|METE_BACC3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain 03BB102) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A0RI12|METE_BACAH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q819H7|METE_BACCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B7IVP2|METE_BACC2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain G9842) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|C3LI71|METE_BACAC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A1W0I5|METE_CAMJJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q6KNA9|METE_BACAN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis GN=metE PE=3 SV=1 2 761 0.0E+00
sp|C3P710|METE_BACAA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis (strain A0248) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q9PN94|METE_CAMJE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q731W2|METE_BACC1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B9IWL4|METE_BACCQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain Q1) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B7HMX7|METE_BACC7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain AH187) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A7Z3U1|METE_BACMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|B7H8Z2|METE_BACC4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain B4264) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q71YY6|METE_LISMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|C1KVY0|METE_LISMC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|Q8NRB3|METE_CORGL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B7JKY0|METE_BACC0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain AH820) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A4QDA4|METE_CORGB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium glutamicum (strain R) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A7GS30|METE_BACCN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q8FQB2|METE_COREF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q6HEG3|METE_BACHK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q92AX9|METE_LISIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|Q635S6|METE_BACCZ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A0AJD5|METE_LISW6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|Q117R7|METE_TRIEI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q65KT8|METE_BACLD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|Q2JKE8|METE_SYNJB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=metE PE=3 SV=1 4 757 0.0E+00
sp|P65343|METE_STAAN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain N315) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|P65342|METE_STAAM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A7WY46|METE_STAA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A5IPT7|METE_STAA9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain JH9) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A6TYK8|METE_STAA2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain JH1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5HS05|METE_STAEQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8CMP5|METE_STAES 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8NY94|METE_STAAW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MW2) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q6GCB6|METE_STAAS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q6GJW2|METE_STAAR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A8YZI1|METE_STAAT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A6QE38|METE_STAAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Newman) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5HIT8|METE_STAAC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain COL) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2YVH7|METE_STAAB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2G122|METE_STAA8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2FJQ7|METE_STAA3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain USA300) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q4L330|METE_STAHJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q9KFP1|METE_BACHD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metE PE=3 SV=1 2 754 0.0E+00
sp|O67606|METE_AQUAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Aquifex aeolicus (strain VF5) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q8CWX6|METE_STRMU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metE PE=1 SV=1 1 762 0.0E+00
sp|Q88X63|METE_LACPL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metE PE=3 SV=1 2 756 0.0E+00
sp|A5IMS4|METE_THEP1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=metE PE=3 SV=1 7 764 0.0E+00
sp|P65345|METE_STRA5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|P65344|METE_STRA3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q3JYS3|METE_STRA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q8DJY0|METE_THEEB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B1LC63|METE_THESQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga sp. (strain RQ2) GN=metE PE=3 SV=1 7 764 0.0E+00
sp|Q9X112|METE_THEMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=metE PE=1 SV=1 7 764 0.0E+00
sp|A9B0A2|METE_HERA2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=metE PE=3 SV=1 4 761 1.0E-180
sp|Q39586|METE_CHLRE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chlamydomonas reinhardtii PE=2 SV=1 1 761 2.0E-169
sp|Q9YA91|METE_AERPE Methionine synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=metE PE=3 SV=1 435 764 1.0E-48
sp|C3MWZ5|METE_SULIM Methionine synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=metE PE=3 SV=1 433 762 1.0E-45
sp|C3MR07|METE_SULIL Methionine synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=metE PE=3 SV=1 433 762 1.0E-45
sp|C4KID3|METE_SULIK Methionine synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=metE PE=3 SV=1 433 762 1.0E-45
sp|C3MZ55|METE_SULIA Methionine synthase OS=Sulfolobus islandicus (strain M.16.27) GN=metE PE=3 SV=1 433 762 1.0E-45
sp|C3NGG0|METE_SULIN Methionine synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=metE PE=3 SV=1 433 762 2.0E-45
sp|C3N775|METE_SULIY Methionine synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=metE PE=3 SV=1 433 762 2.0E-45
sp|Q980A9|METE_SULSO Methionine synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=metE PE=3 SV=1 433 762 6.0E-45
sp|Q4JAI4|METE_SULAC Methionine synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=metE PE=3 SV=1 436 762 2.0E-43
sp|Q975N4|METE_SULTO Methionine synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=metE PE=3 SV=1 433 762 4.0E-43
sp|Q5JH51|METE_THEKO Methionine synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=metE PE=3 SV=1 431 765 3.0E-31
sp|Q8TH63|METE_PYRFU Methionine synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=metE PE=3 SV=1 431 762 1.0E-30
sp|O58816|METE_PYRHO Methionine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=metE PE=3 SV=1 431 762 1.0E-27
sp|Q9V085|METE_PYRAB Methionine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=metE PE=3 SV=1 431 762 7.0E-27
sp|Q979L4|METE_THEVO Methionine synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=metE PE=3 SV=2 438 754 4.0E-25
sp|P57704|METE_THEAC Methionine synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=metE PE=3 SV=1 438 763 8.0E-24
sp|Q58868|METE_METJA Methionine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=metE PE=3 SV=2 438 761 9.0E-13
sp|O26869|METE_METTH Methionine synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metE PE=3 SV=1 438 757 2.0E-12
sp|P55299|METE_METTM Methionine synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=metE PE=1 SV=3 438 757 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008652 cellular amino acid biosynthetic process Yes
GO:0008270 zinc ion binding Yes
GO:0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity Yes
GO:0009086 methionine biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0006520 cellular amino acid metabolic process No
GO:0000096 sulfur amino acid metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0000097 sulfur amino acid biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008168 methyltransferase activity No
GO:0019752 carboxylic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044272 sulfur compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009067 aspartate family amino acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0042085 5-methyltetrahydropteroyltri-L-glutamate-dependent methyltransferase activity No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0046914 transition metal ion binding No
GO:0009066 aspartate family amino acid metabolic process No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0008172 S-methyltransferase activity No
GO:0003824 catalytic activity No
GO:0006555 methionine metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0009987 cellular process No
GO:0044283 small molecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071260
MVLSSVLGFPRIGANREIKKAVEAYWAGKTSAEDLQKVAAEVRKTSWTSVKNHRVDFVPSGEFSLYDHVLDHSAA
FNVIPQRYVGLGLTPLDVYFAMGRGRQSEGVDVPASEMKKWFDSNYHYVVPELSEETDLKLIYNKALEEFKEAKE
AGITTRPVVLGPVSFLVLGKSAKSAQPGFRPISLLPKLIPVYKQLLSELKAAGAEWVQIDEPILALDSAAALEKE
YTASFTELAPVSPKIMLTTYFSRLDSNVRFIAKLPVAGLHIDLDRAPDQLTEVANAVKSTPIVLSLGLVSGRNIW
KTDFGAAVKLAQTAIDILGAGRVIVATSSSLLHTPVTLASENKLTAEQKDWFSFALEKAEEVAVIAAVLSGSQDA
SVTAALEANRVSINKRREFEKNSDDTVRKRVAAITPDQLNRKSPFPVRKETQAKHLNLPKFPTTTIGSFPQTKEI
RQARAKFNKGELTEEEYETFIKKEIEHVVRFQESIDLDILVHGEPERNDMVQYFGELLNGFVFTQNAWVQSYGSR
YVRPPIIVSDVSRPGPMTVKWSSYAQSLTKKPMKGMLTGPVTILNWSFPRADISREMQSKQLALALRDEVIDLEN
AGIHAIQVDEPAIREGLPLRRADWDGYLEWAVDSFKLATAGVTDQLQTHSHFCYSDFDDIFPSIQRLDADVISIE
ASKSDMKLLNTFKHYGYSNQIGPGVYDIHSPRVPGDQEIKDRLQAMLSILPDSLVFVNPDCGLKTRGWKETEASL
KNLVAGAKWARQNYA*
Coding >Agabi119p4|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATAC
TGGGCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTC
AAAAATCATCGCGTCGACTTTGTTCCTAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCT
TTCAATGTCATTCCCCAACGTTATGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGA
CGTCAATCCGAGGGTGTCGACGTCCCCGCTTCCGAGATGAAGAAATGGTTTGACTCAAACTACCATTATGTCGTT
CCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTCTTGAGGAGTTCAAAGAAGCCAAGGAG
GCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTGTTCTAGGAAAGAGTGCCAAATCCGCT
CAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCTACAAGCAACTTCTTTCGGAGCTGAAA
GCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTGATAGCGCTGCCGCCCTCGAGAAGGAG
TATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGCTCACCACTTACTTTTCCCGCCTCGAT
TCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCGATCTCGATCGCGCCCCTGATCAACTC
ACTGAGGTCGCCAATGCAGTTAAGAGCACTCCTATTGTACTTTCGTTGGGCCTCGTTTCCGGCCGCAACATATGG
AAAACCGATTTCGGCGCTGCTGTCAAGCTCGCTCAAACTGCTATTGACATCCTTGGTGCTGGTCGTGTCATTGTT
GCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGAATAAGCTGACTGCAGAGCAGAAGGAT
TGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCGCCGTTCTTTCCGGCTCTCAAGATGCC
TCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTCGTGAGTTTGAGAAGAACTCTGATGAC
ACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCAAGAGCCCCTTCCCGGTTCGAAAAGAA
ACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCGGTTCCTTCCCTCAAACAAAGGAAATT
CGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCGAAGAGGAGTATGAAACGTTCATCAAAAAAGAAATC
GAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGACATG
GTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTCTCGC
TATGTGCGCCCTCCCATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCA
CAGAGCCTCACCAAGAAACCCATGAAGGGCATGTTAACTGGTCCTGTTACCATTCTCAACTGGTCATTCCCTCGG
GCCGACATCTCACGTGAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAAT
GCTGGAATTCATGCTATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTCTTCCCCTCCGCCGGGCTGACTGGGAT
GGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGCAACAGCTGGTGTCACTGATCAACTTCAGACTCACTCT
CACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTCTATTCAACGCCTTGACGCTGATGTTATTTCGATCGAG
GCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAAGCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTC
TATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGAGATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTG
CCAGACTCTCTTGTCTTTGTTAACCCTGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAGACAGAAGCTTCTCTG
AAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA
Transcript >Agabi119p4|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATAC
TGGGCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTC
AAAAATCATCGCGTCGACTTTGTTCCTAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCT
TTCAATGTCATTCCCCAACGTTATGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGA
CGTCAATCCGAGGGTGTCGACGTCCCCGCTTCCGAGATGAAGAAATGGTTTGACTCAAACTACCATTATGTCGTT
CCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTCTTGAGGAGTTCAAAGAAGCCAAGGAG
GCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTGTTCTAGGAAAGAGTGCCAAATCCGCT
CAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCTACAAGCAACTTCTTTCGGAGCTGAAA
GCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTGATAGCGCTGCCGCCCTCGAGAAGGAG
TATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGCTCACCACTTACTTTTCCCGCCTCGAT
TCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCGATCTCGATCGCGCCCCTGATCAACTC
ACTGAGGTCGCCAATGCAGTTAAGAGCACTCCTATTGTACTTTCGTTGGGCCTCGTTTCCGGCCGCAACATATGG
AAAACCGATTTCGGCGCTGCTGTCAAGCTCGCTCAAACTGCTATTGACATCCTTGGTGCTGGTCGTGTCATTGTT
GCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGAATAAGCTGACTGCAGAGCAGAAGGAT
TGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCGCCGTTCTTTCCGGCTCTCAAGATGCC
TCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTCGTGAGTTTGAGAAGAACTCTGATGAC
ACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCAAGAGCCCCTTCCCGGTTCGAAAAGAA
ACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCGGTTCCTTCCCTCAAACAAAGGAAATT
CGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCGAAGAGGAGTATGAAACGTTCATCAAAAAAGAAATC
GAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGACATG
GTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTCTCGC
TATGTGCGCCCTCCCATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCA
CAGAGCCTCACCAAGAAACCCATGAAGGGCATGTTAACTGGTCCTGTTACCATTCTCAACTGGTCATTCCCTCGG
GCCGACATCTCACGTGAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAAT
GCTGGAATTCATGCTATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTCTTCCCCTCCGCCGGGCTGACTGGGAT
GGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGCAACAGCTGGTGTCACTGATCAACTTCAGACTCACTCT
CACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTCTATTCAACGCCTTGACGCTGATGTTATTTCGATCGAG
GCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAAGCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTC
TATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGAGATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTG
CCAGACTCTCTTGTCTTTGTTAACCCTGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAGACAGAAGCTTCTCTG
AAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA
Gene >Agabi119p4|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGTGAGTCTCGATCTTTCGCGTTCGGCTTTGATGTTTCC
CTTGACATCCTTTTTCTGATTGTGACATATATAGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATACTGG
GCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTCAAA
AATCATCGCGTCGACTTTGTTCCTAGGTGTGTTTACAACTGATCAATCAGGTCAGCACGAAGGTCTAAAAATGTT
ACACAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCTTTCAATGTCATTCCCCAACGTTA
TGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGACGTCAATCCGAGGGTGTCGACGT
CCCCGCTTCCGAGATGAAGAAATGGCAAGTGTCAACTATGTCGATATTTAAATGAATATTAATCATCTTGTAGGT
TTGACTCAAACTACCATTATGTCGTTCCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTC
TTGAGGAGTTCAAAGAAGCCAAGGAGGCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTG
TTCTAGGAAAGAGTGCCAAATCCGCTCAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCT
ACAAGCAACTTCTTTCGGAGCTGAAAGCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTG
ATAGCGCTGCCGCCCTCGAGAAGGAGTATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGC
TCACCACTTACTTTTCCCGCCTCGATTCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCG
ATCTCGATCGCGCCCCTGATCAACTCACTGAGGTCGCCAATGCAGTTAAGAGCACTCCTATTGTACTTTCGTTGG
GCCTCGTTTCCGGCCGCAACATATGGAAAACCGATTTCGGCGCTGCTGTCAAGCTCGCTCAAACTGCTATTGACA
TCCTTGGTGCTGGTCGTGTCATTGTTGCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGA
ATAAGCTGACTGCAGAGCAGAAGGATTGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCG
CCGTTCTTTCCGGCTCTCAAGATGCCTCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTC
GTGAGTTTGAGAAGAACTCTGATGACACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCA
AGAGCCCCTTCCCGGTTCGAAAAGAAACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCG
GTTCCTTCCCTGTTCGCATGTTTCCCTTGATGTGGTGGTCCAAATACTAACATCTAGTGTATAGCAAACAAAGGA
AATTCGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCGAAGAGGAGTATGAAACGTTCATCAAAAAAGA
AATCGAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGA
CATGGTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTC
TCGGTATGTTCACGTTTATATCTGATTCAGTTGTATCTCATTTACCGCCACTCTATCAGCTATGTGCGCCCTCCC
ATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCACAGAGCCTCACCAAG
AAACCCATGAAGGGCATGTTAACTGGTCCTGTTACCATTCTCAACTGGTCATTCCCTCGGGCCGACATCTCACGT
GAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAATGCTGGAATTCATGCT
ATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTGTAAGTTGTTTTACCTTCGTTTTGAAGGATTACAGTGATTGA
TACTCTGTAGCTTCCCCTCCGCCGGGCTGACTGGGATGGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGC
AACAGCTGGTGTCACTGATCAACTTCAGACTCACTCTCACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTC
TATTCAACGCCTTGACGCTGATGTTATTTCGATCGAGGCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAA
GCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTCTATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGA
GATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTGCCAGACTCTCTTGTCTTTGTTAACCCTGTAAGAAGTCT
TGATGCTCTCTCCTAATCAAACATTCACCGGCTACCATATAGGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAG
ACAGAAGCTTCTCTGAAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail