Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071100
Gene name
Locationscaffold_04:1321003..1322516
Strand-
Gene length (bp)1513
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03676 PHAF1 Phagosome assembly factor 1 9.9E-72 19 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SD33|U183_ARATH UPF0183 protein At3g51130 OS=Arabidopsis thaliana GN=At3g51130 PE=2 SV=2 10 402 6.0E-30
sp|Q9BSU1|CP070_HUMAN UPF0183 protein C16orf70 OS=Homo sapiens GN=C16orf70 PE=1 SV=1 8 402 9.0E-25
sp|O08654|CP070_RAT UPF0183 protein C16orf70 homolog OS=Rattus norvegicus PE=2 SV=1 8 402 1.0E-24
sp|Q922R1|CP070_MOUSE UPF0183 protein C16orf70 homolog OS=Mus musculus PE=1 SV=2 8 402 1.0E-24
sp|Q9VSH9|U183_DROME UPF0183 protein CG7083 OS=Drosophila melanogaster GN=CG7083 PE=2 SV=1 238 402 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SD33|U183_ARATH UPF0183 protein At3g51130 OS=Arabidopsis thaliana GN=At3g51130 PE=2 SV=2 10 402 6.0E-30
sp|Q9BSU1|CP070_HUMAN UPF0183 protein C16orf70 OS=Homo sapiens GN=C16orf70 PE=1 SV=1 8 402 9.0E-25
sp|O08654|CP070_RAT UPF0183 protein C16orf70 homolog OS=Rattus norvegicus PE=2 SV=1 8 402 1.0E-24
sp|Q922R1|CP070_MOUSE UPF0183 protein C16orf70 homolog OS=Mus musculus PE=1 SV=2 8 402 1.0E-24
sp|Q9VSH9|U183_DROME UPF0183 protein CG7083 OS=Drosophila melanogaster GN=CG7083 PE=2 SV=1 238 402 5.0E-21
sp|P34692|U183_CAEEL UPF0183 protein T01G9.2 OS=Caenorhabditis elegans GN=T01G9.2 PE=1 SV=3 21 402 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071100
MTNPYSTLEFDIHPGTSLGLFEIGSSLWTILETLRRLQHQYPQVDIKFDPDSSTTTPILIHLRPHISLLFSGLHQ
RLHTISIHSLQTSNPPIILKYKDTVLSSSKDEIVLRRVSVNRTFGPTYPSGSGSDDLKYPGIWFSFEEDSGGGGV
TTTTTKVAENHRKGKEIEDRSNEVKKIMILQKCNDGKIQDPLDGVTECNVMHGDIERAIIKVHDGIRLYFSPLST
TNKPLHIRLHQTTAQDLTLDLGPPLRIHYKEDERMTIHSTENAEDDTNDESDYFYNYFQHGLDFFISGSTHTVKK
IIIHSNIPGSPLFQRYKRCNWEIEGEPEDDEDDTPPRKRFYDRFETISHFLSPKETPPSMVLNRTDDEDGLQLPN
ATTRLYGYDGIILEVLESSQVVSVTLF*
Coding >Agabi119p4|071100
ATGACAAACCCATATTCCACTCTCGAATTCGACATTCATCCAGGTACAAGTCTCGGGTTATTCGAAATCGGTTCA
TCACTTTGGACTATCCTCGAAACTCTACGTAGGCTGCAACACCAATACCCCCAAGTCGACATCAAATTCGACCCA
GATTCTTCAACAACAACACCTATACTAATCCATCTTCGTCCTCACATCTCTCTCCTCTTCTCCGGCCTCCATCAA
CGTCTTCACACCATCTCTATCCATTCTCTTCAAACCTCCAACCCACCTATCATTCTCAAATATAAAGATACCGTA
CTTTCTTCTTCAAAGGATGAAATTGTACTTAGGAGGGTGAGTGTGAATAGGACTTTTGGGCCGACGTATCCTTCG
GGTTCGGGATCGGATGATTTGAAGTATCCTGGAATTTGGTTTAGTTTTGAAGAGGATAGTGGTGGTGGGGGTGTG
ACTACGACTACGACCAAGGTTGCTGAGAATCACAGGAAGGGAAAAGAAATAGAAGATAGATCAAACGAAGTCAAG
AAGATCATGATCCTCCAGAAATGTAATGACGGAAAAATCCAAGACCCTTTAGACGGCGTAACAGAATGTAATGTC
ATGCACGGTGATATCGAACGCGCCATCATCAAGGTCCATGATGGAATTCGTCTTTACTTTTCCCCACTATCAACA
ACCAACAAACCCCTTCATATCCGATTACATCAAACAACAGCACAAGACTTGACATTAGATCTCGGTCCGCCTTTA
CGAATTCATTACAAAGAAGATGAACGTATGACCATTCATTCTACTGAAAATGCCGAAGACGACACCAACGACGAA
TCAGACTATTTTTACAATTACTTTCAACACGGCCTCGATTTTTTCATTTCTGGGAGTACACACACTGTAAAGAAA
ATCATCATTCACAGTAACATCCCTGGGTCTCCACTCTTCCAACGGTACAAGCGATGCAATTGGGAAATCGAAGGC
GAACCAGAAGACGACGAAGACGACACACCTCCACGCAAACGATTCTACGATCGGTTCGAAACCATCAGTCATTTC
CTTAGCCCAAAGGAAACACCACCATCAATGGTTTTGAATCGAACCGACGACGAAGACGGCTTACAATTACCCAAT
GCAACAACACGTTTGTATGGTTATGATGGCATAATTCTAGAAGTTTTGGAATCGTCGCAAGTTGTTTCTGTTACC
CTCTTCTAA
Transcript >Agabi119p4|071100
ATGACAAACCCATATTCCACTCTCGAATTCGACATTCATCCAGGTACAAGTCTCGGGTTATTCGAAATCGGTTCA
TCACTTTGGACTATCCTCGAAACTCTACGTAGGCTGCAACACCAATACCCCCAAGTCGACATCAAATTCGACCCA
GATTCTTCAACAACAACACCTATACTAATCCATCTTCGTCCTCACATCTCTCTCCTCTTCTCCGGCCTCCATCAA
CGTCTTCACACCATCTCTATCCATTCTCTTCAAACCTCCAACCCACCTATCATTCTCAAATATAAAGATACCGTA
CTTTCTTCTTCAAAGGATGAAATTGTACTTAGGAGGGTGAGTGTGAATAGGACTTTTGGGCCGACGTATCCTTCG
GGTTCGGGATCGGATGATTTGAAGTATCCTGGAATTTGGTTTAGTTTTGAAGAGGATAGTGGTGGTGGGGGTGTG
ACTACGACTACGACCAAGGTTGCTGAGAATCACAGGAAGGGAAAAGAAATAGAAGATAGATCAAACGAAGTCAAG
AAGATCATGATCCTCCAGAAATGTAATGACGGAAAAATCCAAGACCCTTTAGACGGCGTAACAGAATGTAATGTC
ATGCACGGTGATATCGAACGCGCCATCATCAAGGTCCATGATGGAATTCGTCTTTACTTTTCCCCACTATCAACA
ACCAACAAACCCCTTCATATCCGATTACATCAAACAACAGCACAAGACTTGACATTAGATCTCGGTCCGCCTTTA
CGAATTCATTACAAAGAAGATGAACGTATGACCATTCATTCTACTGAAAATGCCGAAGACGACACCAACGACGAA
TCAGACTATTTTTACAATTACTTTCAACACGGCCTCGATTTTTTCATTTCTGGGAGTACACACACTGTAAAGAAA
ATCATCATTCACAGTAACATCCCTGGGTCTCCACTCTTCCAACGGTACAAGCGATGCAATTGGGAAATCGAAGGC
GAACCAGAAGACGACGAAGACGACACACCTCCACGCAAACGATTCTACGATCGGTTCGAAACCATCAGTCATTTC
CTTAGCCCAAAGGAAACACCACCATCAATGGTTTTGAATCGAACCGACGACGAAGACGGCTTACAATTACCCAAT
GCAACAACACGTTTGTATGGTTATGATGGCATAATTCTAGAAGTTTTGGAATCGTCGCAAGTTGTTTCTGTTACC
CTCTTCTAA
Gene >Agabi119p4|071100
ATGACAAACCCATATTCCACTCTCGAATTCGACATTCATCCAGGTACAAGTCTCGGGTTATTCGAAATCGGTATA
CGGTATTTTCTTGTTATAATTTCCCTCGCCTAATTTCCAATTTCAGGTTCATCACTTTGGACTATCCTCGAAACT
CTACGTAGGCTGCAACACCAATACCCCCAAGTCGACATCAAATTCGACCCAGATTCTTCAACAACAACACCTATA
CTAATCCATCTTCGTCCTCACATCTCTCTCCTCTTCTCCGGCCTCCATCAACGTCTTCACACCATCTCTATCCAT
TCTCTTCAAACCTCCAACCCACCTATCATTCTCAAATATAAAGATACCGTACTTTCTTCTTCAAAGGATGAAATT
GTACTTAGGAGGGTGAGTGTGAATAGGACTTTTGGGCCGACGTATCCTTCGGGTTCGGGATCGGATGATTTGAAG
TATCCTGGAATTTGGTTTAGTTTTGAAGAGGATAGTGGTGGTGGGGGTGTGACTACGACTACGACCAAGGTTGCT
GAGAATCACAGGAAGGGAAAAGAAATAGAAGATAGATCAAACGAAGTCAAGAAGATCATGATCCTCCAGAAATGT
AATGACGGAAAAATCCAAGACCCTTTAGACGGCGTAACAGAATGTAATGTCATGCACGGTGATATCGAACGCGCC
ATCATCAAGGTACTTAACTTCCCTCCCTTTCCTCCCCAAACTGCTACACCATCTTAGGTCCATGATGGAATTCGT
CTTTACTTTTCCCCACTATCAACAACCAACAAACCCCTTCATATCCGATTACATCAAACAACAGCACAAGACTTG
ACATTAGATCTCGGTCCGCCTTTACGAATTCATTACAAAGAAGATGAACGTATGACCATTCATTCTACTGAAAAT
GCCGAAGACGACACCAACGACGAATCAGACTGTATGTACCTCTTCATTTCGTTGTGTATTCAACTCTGAATGTTT
TCAAGATTTTTACAATTACTTTCAACACGGCCTCGATTTTTTCATTTCTGGGAGTACACACACTGTAAAGAAAAT
CATCATTCACAGTAACATCGCAAGTTCTATTCCACTTTCCGAAATACATCAATCTAATGGTACAAAAACAGCCTG
GGTCTCCACTCTTCCAACGGTACAAGCGATGCAATTGGGAAATCGAAGGCGAACCAGAAGACGACGAAGACGGTC
CGTTTTTTAGGTCCCAGAATTCCACTCAAATGTTTATTGTTGGATAGACACACCTCCACGCAAACGATTCTACGA
TCGGTTCGAAACCATCAGTCATTTCCTTAGCCCAAAGGAAACACCACCATCAATGGTTTTGAATCGAACCGACGA
CGAAGACGGCTTACAATTACCCAATGCAACAACACGTTGTACGATTCCAATTTCCTTTCTTCGTTGTAAAGCTGA
CCTGATCTTCCATCCAGTGTATGGTTATGATGGCATAATTCTAGAAGTTTTGGAATCGTCGCAAGTTGTTTCTGT
TACCCTCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail