Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|071040
Gene name
Locationscaffold_04:1310500..1311803
Strand-
Gene length (bp)1303
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 5.2E-09 11 84
PF05368 NmrA NmrA-like family 4.4E-08 9 79

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K4|YGI2_SCHPO Uncharacterized protein C2A9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.02 PE=3 SV=1 5 323 1.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|071040
MSSTLKFFFIGATGYVGSSVLERFLDHPEANNFEFTALVRDPRKAEKLKQFGVNAVVGSFDDAKLVEDLTAAADI
VVDMGGSDNLGLAKSTLRGFQRKFQETGKPSIFIHTSGTIIIADDAAGLHSSGVVWNDADPDQIEQLPPAAPHID
VELEIIRADKEGYVRAYFVTPGTIYGIASGKFVDAGLAHKHSIQVPALIKTSLDRGQAGMIGKGLNIWPNVHIDE
AADFYIDLYNAIKANPDSVGHGRDGFYFLLNGEHSLYDVGKEIGRALVALGKVTTEVPSTYTQEEVNKYFGGSNF
LGTNSRGLANHSKSIGWKPKKTTQDLMASIKPEVEEILKHL*
Coding >Agabi119p4|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAA
TTCGGCGTGAACGCCGTTGTCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGATAACCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAGCGGGTCTTCAT
TCTTCTGGTGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAGCTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCAGGTACCTGCCCTCATCAAG
ACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAAACGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAAGTACCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAAGCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Transcript >Agabi119p4|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAA
TTCGGCGTGAACGCCGTTGTCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGATAACCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAGCGGGTCTTCAT
TCTTCTGGTGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAGCTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCAGGTACCTGCCCTCATCAAG
ACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAAACGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAAGTACCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAAGCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Gene >Agabi119p4|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGTCAGCTCAAATTCACATTTCTTTGCAATAGTTCG
TCTCAGACTAATCATCCTCAGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTTGATCATCCGGAGGCCAATA
ATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAATTCGGCGTGAACGCCGTTG
TCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATCGTGGTTGACATGGTTAGTT
AGAATAATATTCATTCGTTTATAAGGTAGTCTTAAAAACCCATGCTTCAGGGAGGCTCAGATAACCTCGGACTTG
CCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAAGAAACAGGAAAACCTTCAATTTTTATTCACACCGTAA
GTCTTCGTGGATATCTATTTGGGGCTAGCCGTTCCTACTCAACTCTCCAGTCCGGAACCATCATCATAGCCGATG
ATGCAGCGGGTCTTCATTCTTCTGGTGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAG
CTGCACCCCATATCGACGTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGA
CTCCCGGCACAATATATGGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCAGG
TACCTGCCCTCATCAAGACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAA
ACGTTCATATTGATGAAGGTCAGCTCACTGACTCCCTTGGTCCGAGTCCGTTCATTTATTTGGAAATTAGCCGCC
GATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGGTTCTAT
TTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTCGGCAAG
GTAACCACCGAAGTACCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGTGAGTTTTCATCATTCT
TGGGCTCGTTGAGGACAGGTTGAACTTGACGTTTTCATAGGGATCTAATTTCTTGGGCACAAACTCGAGGGGTTT
GGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGATCTTATGGCGAGCATTAAGCCTGA
AGTAGAGGAGATTCTCAAGCATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail