Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|070920
Gene name
Locationscaffold_04:1284761..1286174
Strand-
Gene length (bp)1413
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09724 Dcc1 Sister chromatid cohesion protein Dcc1 6.7E-89 19 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55BA5|DCC1_DICDI Probable sister chromatid cohesion protein DCC1 OS=Dictyostelium discoideum GN=DDB_G0271400 PE=3 SV=1 12 367 1.0E-20
sp|Q6GL75|DCC1_XENTR Sister chromatid cohesion protein DCC1 OS=Xenopus tropicalis GN=dscc1 PE=2 SV=1 7 373 2.0E-20
sp|Q6GMB0|DCC1_XENLA Sister chromatid cohesion protein DCC1 OS=Xenopus laevis GN=dscc1 PE=2 SV=1 7 360 2.0E-19
sp|Q14AI0|DCC1_MOUSE Sister chromatid cohesion protein DCC1 OS=Mus musculus GN=DSCC1 PE=2 SV=1 9 360 3.0E-18
sp|Q9BVC3|DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo sapiens GN=DSCC1 PE=1 SV=2 19 358 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55BA5|DCC1_DICDI Probable sister chromatid cohesion protein DCC1 OS=Dictyostelium discoideum GN=DDB_G0271400 PE=3 SV=1 12 367 1.0E-20
sp|Q6GL75|DCC1_XENTR Sister chromatid cohesion protein DCC1 OS=Xenopus tropicalis GN=dscc1 PE=2 SV=1 7 373 2.0E-20
sp|Q6GMB0|DCC1_XENLA Sister chromatid cohesion protein DCC1 OS=Xenopus laevis GN=dscc1 PE=2 SV=1 7 360 2.0E-19
sp|Q14AI0|DCC1_MOUSE Sister chromatid cohesion protein DCC1 OS=Mus musculus GN=DSCC1 PE=2 SV=1 9 360 3.0E-18
sp|Q9BVC3|DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo sapiens GN=DSCC1 PE=1 SV=2 19 358 8.0E-18
sp|Q66I84|DCC1_DANRE Sister chromatid cohesion protein DCC1 OS=Danio rerio GN=dscc1 PE=2 SV=1 7 360 1.0E-17
sp|P25559|DCC1_YEAST Sister chromatid cohesion protein DCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCC1 PE=1 SV=2 18 360 6.0E-15
sp|Q09732|DCC1_SCHPO Sister chromatid cohesion protein dcc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcc1 PE=3 SV=2 54 373 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0031390 Ctf18 RFC-like complex Yes
GO:0007064 mitotic sister chromatid cohesion Yes
GO:1903047 mitotic cell cycle process No
GO:0006996 organelle organization No
GO:0032991 protein-containing complex No
GO:0022402 cell cycle process No
GO:0051276 chromosome organization No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0007062 sister chromatid cohesion No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|070920
MPSYDLCFSAHADVESASFKLLELTPELAELLEEAAKSLTTVTFAIKGRTGEDAVLCTTDKTYSLRSVALSNSVL
VVTPPSSGSSISTTRGIEPVVIRDELHEILEISPSVPKLHGLISQLRGKEYDESDEVEDNASHSDNYYSYQDAKT
DVQASDEELDRGLKERRVLVINGFLRPISKDYLKTLLELVLNLLASLSLRSDNIPLDDLVSSLAQDHEVPRAVSM
QLLAWFGDVDEAQGSWTMDVQAVVKEVGIGLMRHHRRDPIRKDAFLAQWKATVGDTFNPSVDLRLLTGNYLVSTT
GEQENLVYFPSTELPIDPAQRLADLFRKRSRWTGDDIMPFLSEIAVGPKERDKLLLKYCRVITDPQGVWYTSRTQ
YTG*
Coding >Agabi119p4|070920
ATGCCTTCCTACGACTTGTGCTTTTCAGCACATGCTGATGTCGAATCCGCGTCATTTAAGCTCCTGGAACTCACA
CCGGAACTCGCAGAACTACTTGAAGAAGCTGCCAAGAGTTTGACGACCGTCACGTTTGCAATCAAAGGGCGAACG
GGAGAGGATGCAGTGCTGTGCACAACTGACAAGACCTACAGTCTACGATCTGTGGCCTTGTCGAACTCTGTACTG
GTTGTAACTCCCCCTTCAAGCGGGTCCTCGATAAGCACTACCAGAGGTATAGAACCCGTGGTCATACGTGATGAA
CTACACGAGATTCTCGAAATATCACCTTCTGTCCCTAAACTTCACGGCCTGATTAGCCAGTTGCGAGGAAAGGAA
TACGACGAATCGGATGAAGTAGAAGATAACGCCTCTCACTCAGACAATTACTATTCTTACCAGGATGCCAAGACC
GACGTACAGGCAAGTGACGAAGAGTTGGATCGCGGATTGAAGGAGAGGCGAGTTTTGGTGATTAATGGCTTCTTG
CGCCCAATATCAAAAGACTACTTGAAAACCTTATTGGAATTAGTCTTAAATCTCTTGGCATCACTGTCTCTACGG
TCTGATAATATTCCGCTCGACGATTTGGTTTCTTCACTTGCTCAAGACCACGAGGTGCCGAGAGCAGTCTCAATG
CAACTGCTGGCGTGGTTTGGAGATGTAGACGAAGCACAGGGTTCATGGACAATGGATGTCCAAGCGGTCGTAAAA
GAAGTAGGGATTGGGTTGATGAGACATCATCGGCGCGATCCGATCAGAAAGGATGCGTTTTTAGCTCAGTGGAAA
GCAACTGTTGGAGATACTTTCAATCCCTCGGTCGATCTCAGGCTCCTAACTGGTAATTACCTGGTTTCAACGACT
GGTGAACAGGAGAATCTGGTGTACTTTCCTTCGACAGAGCTGCCCATAGACCCAGCGCAGCGTTTAGCTGACCTT
TTCCGCAAAAGATCACGTTGGACGGGGGATGATATCATGCCTTTTCTTAGTGAGATTGCAGTCGGCCCCAAGGAA
CGAGATAAACTGCTTCTCAAGTACTGTCGCGTTATTACAGATCCCCAAGGAGTTTGGTATACTTCACGAACACAA
TATACTGGCTGA
Transcript >Agabi119p4|070920
ATGCCTTCCTACGACTTGTGCTTTTCAGCACATGCTGATGTCGAATCCGCGTCATTTAAGCTCCTGGAACTCACA
CCGGAACTCGCAGAACTACTTGAAGAAGCTGCCAAGAGTTTGACGACCGTCACGTTTGCAATCAAAGGGCGAACG
GGAGAGGATGCAGTGCTGTGCACAACTGACAAGACCTACAGTCTACGATCTGTGGCCTTGTCGAACTCTGTACTG
GTTGTAACTCCCCCTTCAAGCGGGTCCTCGATAAGCACTACCAGAGGTATAGAACCCGTGGTCATACGTGATGAA
CTACACGAGATTCTCGAAATATCACCTTCTGTCCCTAAACTTCACGGCCTGATTAGCCAGTTGCGAGGAAAGGAA
TACGACGAATCGGATGAAGTAGAAGATAACGCCTCTCACTCAGACAATTACTATTCTTACCAGGATGCCAAGACC
GACGTACAGGCAAGTGACGAAGAGTTGGATCGCGGATTGAAGGAGAGGCGAGTTTTGGTGATTAATGGCTTCTTG
CGCCCAATATCAAAAGACTACTTGAAAACCTTATTGGAATTAGTCTTAAATCTCTTGGCATCACTGTCTCTACGG
TCTGATAATATTCCGCTCGACGATTTGGTTTCTTCACTTGCTCAAGACCACGAGGTGCCGAGAGCAGTCTCAATG
CAACTGCTGGCGTGGTTTGGAGATGTAGACGAAGCACAGGGTTCATGGACAATGGATGTCCAAGCGGTCGTAAAA
GAAGTAGGGATTGGGTTGATGAGACATCATCGGCGCGATCCGATCAGAAAGGATGCGTTTTTAGCTCAGTGGAAA
GCAACTGTTGGAGATACTTTCAATCCCTCGGTCGATCTCAGGCTCCTAACTGGTAATTACCTGGTTTCAACGACT
GGTGAACAGGAGAATCTGGTGTACTTTCCTTCGACAGAGCTGCCCATAGACCCAGCGCAGCGTTTAGCTGACCTT
TTCCGCAAAAGATCACGTTGGACGGGGGATGATATCATGCCTTTTCTTAGTGAGATTGCAGTCGGCCCCAAGGAA
CGAGATAAACTGCTTCTCAAGTACTGTCGCGTTATTACAGATCCCCAAGGAGTTTGGTATACTTCACGAACACAA
TATACTGGCTGA
Gene >Agabi119p4|070920
ATGCCTTCCTACGACTTGTGCTTTTCAGCACATGCTGATGTCGAATCCGCGTCATTTAAGCTCCTGGAACTCACA
CCGGAACTCGCAGAACTACTTGAAGAAGCTGCCAAGAGTTTGACGACCGTCACGTAGGCCTTCTCGACTCGCGTG
GTTCTCCATCTGACCTTGATTCTCAGGTTTGCAATCAAAGGGCGAACGGGAGAGGATGCAGTGCTGTGCACAACT
GACAAGACCTACAGTCTACGATCTGTGGCCTTGTCGAACTCTGTACTGGTTGTAACTCCCCCTTCAAGCGGGTCC
TCGATAAGCACTACCAGAGGTATAGAACCCGTGGTCATACGTGATGAACTACACGAGATTCTCGAAATATCACCT
TCTGTCCCTAAACTTCACGGCCTGATTAGCCAGTTGCGAGGAAAGGAATACGACGAATCGGATGAAGTAGAAGAT
AACGCCTCTCACTCAGACGTACGCGGGTTATCATGCTTAGCTCGGGTCATACGTCTAACAAAGCGGATCTCGACC
AGAATTACTATTCTTACCAGGATGCCAAGACCGACGTACAGGCAAGTGACGAAGAGTTGGATCGCGGATTGAAGG
AGAGGCGAGTTTTGGTGATTAATGGTAAGTTGCTTCCACTCCCTACTTTGAGCGACTGTTTCGCGCAAACTCTCA
ATTTGAATACAGGCTTCTTGCGCCCAATATCAAAAGACTACTTGAAAACCTTATTGGAATTAGTCTTAAATCTCT
TGGCATCACTGTCTCTACGGTCTGATAATATTCCGCTCGACGATTTGGTTTCTTCACTTGCTCAAGACCACGAGG
TGCCGAGAGCAGTCTCAATGCAACTGCTGGCGTGGTTTGGAGATGTAGACGAAGCACAGGGTTCATGGACAATGG
ATGTCCAAGCGGTCGTAAAAGAAGTAGGGATTGGGTTGATGAGACATCATCGGGTGAGCCTATCGCGCTACCTGC
TCGACGACCGGTGAAAGTAAACATGACTTAGCGCGATCCGATCAGAAAGGATGCGTTTTTAGCTCAGTGGAAAGC
AACTGTTGGAGATACTTTCAATCCCTCGGTCGATCTCAGGCTCCTAACTGTGCGTGAATTGTTCATGCTCCGGGA
GTTACTCGTGCTTACTTTGTTTGCCAGGGTAATTACCTGGTTTCAACGACTGGTGAACAGGAGAATCTGGTGTAC
TTTCCTTCGACAGAGCTGCCCATAGACCCAGCGCAGCGTTTAGCTGACCTTTTCCGCAAAAGATCACGTTGGACG
GGGGATGATATCATGCCTTTTCTTAGTGAGATTGCAGTCGGCCCCAAGGAACGAGATAAACTGCTTCTCAAGTAC
TGTCGCGTTATTACAGATCCCCAAGGAGTTTGGTATACTTCACGAACACAATATACTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail