Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|070310
Gene name
Locationscaffold_04:1153984..1157187
Strand+
Gene length (bp)3203
Transcript length (bp)2760
Coding sequence length (bp)2760
Protein length (aa) 920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 3.0E-46 22 262
PF13299 CPSF100_C Cleavage and polyadenylation factor 2 C-terminal 1.7E-23 762 913
PF10996 Beta-Casp Beta-Casp domain 1.7E-19 307 452
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 1.5E-04 682 735

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 75 916 6.0E-106
sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 2 911 2.0E-92
sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 2 911 9.0E-91
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 1 916 9.0E-88
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 1 916 1.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 75 916 6.0E-106
sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 2 911 2.0E-92
sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 2 911 9.0E-91
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 1 916 9.0E-88
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 1 916 1.0E-86
sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 1 916 3.0E-86
sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 1 789 3.0E-70
sp|A8XUS3|CPSF2_CAEBR Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis briggsae GN=cpsf-2 PE=3 SV=2 1 788 7.0E-65
sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 1 506 3.0E-59
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 1 496 1.0E-52
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 1 513 9.0E-44
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 588 916 7.0E-28
sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 588 916 6.0E-27
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 614 916 3.0E-24
sp|Q12102|CFT2_YEAST Cleavage factor two protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFT2 PE=1 SV=1 22 353 4.0E-21
sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 73 453 8.0E-19
sp|O13794|YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ysh1 PE=3 SV=2 73 455 2.0E-18
sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 2 454 2.0E-17
sp|Q9CWS4|INT11_MOUSE Integrator complex subunit 11 OS=Mus musculus GN=Cpsf3l PE=1 SV=1 2 454 2.0E-17
sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2 69 454 4.0E-17
sp|Q5NVE6|INT11_PONAB Integrator complex subunit 11 OS=Pongo abelii GN=CPSF3L PE=2 SV=2 69 454 4.0E-17
sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 2 454 5.0E-17
sp|Q2YDM2|INT11_BOVIN Integrator complex subunit 11 OS=Bos taurus GN=CPSF3L PE=2 SV=2 69 454 5.0E-17
sp|Q503E1|INT11_DANRE Integrator complex subunit 11 OS=Danio rerio GN=cpsf3l PE=2 SV=1 2 454 6.0E-17
sp|Q4WRC2|YSH1_ASPFU Endoribonuclease ysh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ysh1 PE=3 SV=1 73 455 6.0E-16
sp|Q6FUA5|YSH1_CANGA Endoribonuclease YSH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YSH1 PE=3 SV=1 74 453 2.0E-15
sp|Q4IPN9|YSH1_GIBZE Endoribonuclease YSH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YSH1 PE=3 SV=2 73 462 3.0E-15
sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 73 458 3.0E-15
sp|Q5BEP0|YSH1_EMENI Endoribonuclease ysh1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ysh1 PE=3 SV=1 73 455 2.0E-14
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 74 453 3.0E-14
sp|Q74ZC0|YSH1_ASHGO Endoribonuclease YSH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YSH1 PE=3 SV=2 74 452 3.0E-14
sp|Q86A79|CPSF3_DICDI Cleavage and polyadenylation specificity factor subunit 3 OS=Dictyostelium discoideum GN=cpsf3 PE=3 SV=1 63 464 3.0E-13
sp|Q9VE51|CPSF3_DROME Cleavage and polyadenylation specificity factor 73 OS=Drosophila melanogaster GN=Cpsf73 PE=1 SV=2 71 455 3.0E-12
sp|Q8WZS6|YSH1_NEUCR Endoribonuclease ysh-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ysh-1 PE=3 SV=1 73 462 6.0E-12
sp|Q54YL3|INT11_DICDI Integrator complex subunit 11 homolog OS=Dictyostelium discoideum GN=ints11 PE=3 SV=1 69 453 1.0E-11
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 74 453 3.0E-11
sp|Q9QXK7|CPSF3_MOUSE Cleavage and polyadenylation specificity factor subunit 3 OS=Mus musculus GN=Cpsf3 PE=1 SV=2 74 455 1.0E-10
sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1 74 455 2.0E-10
sp|P79101|CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus GN=CPSF3 PE=1 SV=1 74 455 2.0E-10
sp|Q12102|CFT2_YEAST Cleavage factor two protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFT2 PE=1 SV=1 667 916 5.0E-09
sp|Q8K114|INT9_MOUSE Integrator complex subunit 9 OS=Mus musculus GN=Ints9 PE=1 SV=1 73 347 2.0E-06
sp|Q2KJA6|INT9_BOVIN Integrator complex subunit 9 OS=Bos taurus GN=INTS9 PE=2 SV=1 73 347 3.0E-06
sp|Q6DFF4|INT9_XENLA Integrator complex subunit 9 OS=Xenopus laevis GN=ints9 PE=2 SV=1 73 347 3.0E-06
sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2 73 347 4.0E-06
sp|Q4R5Z4|INT9_MACFA Integrator complex subunit 9 OS=Macaca fascicularis GN=INTS9 PE=2 SV=1 73 347 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|070310
MITFTPLSGAARSDSPSPLSYLLQVDDVRMLLDCGSPDWAPENDASTDGENESEEPRHSWSDYCETLRRIAPTID
LVLLSHGDLSHSGLYPYAYSRWGLKAPAYSTLPVQATGKIAAMEDVEGIRDEQDIGDEPIQEAEHQELQSGEDAG
VHKESSLNPTTKTGKFLATLVEVQDAFEYLNTLRYSQPMHLQGKCQGITITPFNAGHTLGGTIWKIRSPTSGTII
YAVHMNHMKERHLDGTVLMKNASGGIFEPLARPDLLITDADRANVITSRRKDRDAALIDTITATLSSRSSLLLPC
DSSTRILELLVLLDQHWSYSRLRYPICLLARTGRDMLAFVRSMMEWLGGTISKEDVGVEATAKQRNKRKRDDDDD
NEALGALALRFKHLEFFPNPQALLQTYSSKDPKLILAVPASLSHGPSRNLFVDFAVVPDNVVLLTGRGEEGSLGR
ALFNKWNDRQRVDDKWDKGKIGSNIMLDGGFRMKMRSKVPLQGAELEAYLQQEKEKKDKEVAQQAALARSQRMLE
ADEDESDSDSDTDEEEEVRRTLEGDMEVDGDGISRRRKRDDTDATDWALDADEGLTKQFLSFDIYLKGNVSRATS
FFKTAGGQTQRFRMFPYVEKKRRVDEYGETIDVGMWLRKGMVLEEEAESDEIKDYKKKLQEEEEAKKIKEPPSKF
VTMDVDVQLACRLLFVDMEGLNDGRAVKTIVPQINPRKMILVSASESASNALIESCSNIRAMTKDIYSPAVGESV
QIGQQTNTFSISISEDLLTSLRMSRFEDNEIGYVRGRVVAHATSTIPTLESVSSLPPTTDRTVVSDPSKSRILGS
RPKVALPQSTMIGELKLTALKQRLAAVNIPAELIGEGVLICGGIRQTDNMDTSEETVAVRKKAKGSVELEGNVSE
LYYKVRREIYNLHAMVAAS*
Coding >Agabi119p4|070310
ATGATCACCTTCACCCCTCTATCCGGAGCTGCTCGCTCAGATTCTCCGTCTCCCCTTTCATATCTCCTGCAGGTT
GATGATGTCCGAATGCTCCTCGATTGTGGCTCTCCGGATTGGGCACCCGAAAATGACGCTTCGACGGATGGTGAG
AATGAGAGCGAAGAGCCGCGACATTCCTGGTCGGACTATTGCGAGACCCTTCGTCGAATAGCACCTACTATTGAT
CTTGTCTTATTGTCCCATGGCGACCTATCACACTCGGGCCTGTATCCATATGCTTACTCGAGATGGGGTCTGAAG
GCACCGGCTTATTCGACGCTACCAGTACAAGCTACAGGGAAGATTGCTGCGATGGAAGACGTGGAAGGAATTCGC
GATGAACAGGATATTGGTGACGAGCCAATACAAGAGGCTGAACACCAAGAATTGCAGTCTGGAGAGGATGCTGGT
GTACACAAGGAATCCTCCCTGAATCCAACGACAAAAACGGGCAAATTTCTTGCTACTCTTGTGGAGGTGCAAGAT
GCTTTCGAATACCTCAATACACTTCGTTATTCTCAACCTATGCATCTCCAAGGGAAATGCCAGGGCATCACTATC
ACGCCTTTCAATGCTGGGCACACATTGGGAGGAACCATTTGGAAAATTCGGTCACCAACGTCTGGAACTATCATA
TACGCTGTACACATGAATCACATGAAAGAGCGGCATTTGGACGGGACCGTTCTAATGAAAAATGCTAGTGGTGGA
ATATTCGAACCTCTAGCGCGGCCAGATTTGCTCATCACGGATGCTGACCGAGCCAATGTTATAACAAGTCGGCGA
AAAGACAGGGATGCCGCTCTCATCGATACCATCACTGCGACTCTCTCATCCCGGTCATCTCTACTTCTCCCCTGT
GATTCCAGCACCCGGATCCTTGAACTTCTGGTGTTACTAGATCAACATTGGAGCTATTCACGACTGCGATATCCA
ATCTGCCTTCTCGCACGAACAGGGAGAGATATGCTTGCTTTCGTTCGGAGTATGATGGAATGGCTAGGTGGTACG
ATAAGCAAAGAAGACGTTGGAGTAGAAGCCACTGCCAAGCAACGGAACAAACGAAAGAGAGATGATGATGATGAT
AACGAAGCACTTGGTGCTCTGGCTTTACGATTCAAACACCTAGAGTTTTTCCCCAACCCCCAGGCTCTTCTACAG
ACATATTCTTCAAAGGACCCCAAGTTAATCCTTGCGGTTCCCGCTTCTTTATCTCACGGGCCCTCGAGGAACCTC
TTTGTAGATTTTGCTGTCGTTCCGGACAATGTCGTTCTACTCACAGGCCGAGGGGAGGAGGGATCACTTGGTCGA
GCACTCTTTAATAAGTGGAATGACAGACAACGTGTAGATGACAAGTGGGACAAAGGCAAGATCGGTAGCAATATC
ATGTTAGATGGTGGATTTCGCATGAAGATGCGTAGCAAAGTGCCGTTGCAAGGCGCCGAACTAGAAGCTTATCTC
CAACAAGAGAAGGAGAAAAAGGATAAAGAAGTAGCTCAGCAAGCTGCACTCGCACGTAGTCAGCGTATGCTTGAA
GCTGATGAGGATGAAAGTGATTCAGACTCGGATACTGACGAAGAAGAAGAGGTAAGGAGGACCTTAGAAGGTGAC
ATGGAGGTTGATGGTGACGGAATATCGCGACGGCGCAAAAGAGATGATACGGATGCAACTGACTGGGCTCTAGAT
GCGGATGAGGGCTTGACGAAACAATTCCTTTCTTTTGATATTTACCTGAAGGGAAATGTGTCAAGAGCTACCTCA
TTTTTCAAGACTGCAGGTGGGCAGACCCAGCGTTTCCGTATGTTCCCATACGTCGAAAAGAAAAGAAGAGTAGAC
GAGTATGGTGAAACAATAGATGTGGGTATGTGGTTGAGGAAGGGAATGGTGCTAGAGGAGGAGGCGGAGAGTGAC
GAAATCAAAGATTATAAGAAAAAGCTCCAAGAAGAGGAAGAAGCCAAGAAAATAAAAGAGCCCCCGTCCAAATTT
GTGACAATGGACGTCGATGTCCAATTAGCTTGTCGACTACTTTTTGTTGACATGGAGGGACTCAATGATGGGCGA
GCCGTAAAAACGATTGTCCCACAAATCAATCCGCGGAAGATGATTCTGGTTTCTGCTTCAGAATCGGCGTCGAAC
GCCCTCATCGAAAGTTGTAGCAATATCCGCGCCATGACGAAGGATATCTATTCTCCCGCTGTAGGCGAGAGCGTT
CAGATCGGCCAACAGACAAACACGTTCTCAATTTCGATCAGTGAAGATCTCCTTACCTCTCTCAGGATGTCCCGG
TTTGAAGATAATGAGATAGGTTATGTGAGGGGCCGAGTTGTCGCCCATGCAACCTCGACAATTCCGACGCTCGAG
TCTGTCTCTTCGCTCCCACCCACCACTGATCGCACTGTTGTCAGTGATCCTTCAAAAAGCCGCATACTTGGCTCG
CGTCCGAAGGTTGCACTGCCTCAGTCAACTATGATTGGGGAACTTAAACTAACCGCGTTGAAACAACGGTTGGCT
GCCGTTAATATTCCCGCTGAATTGATTGGAGAAGGTGTTTTGATCTGTGGAGGCATCAGACAAACTGACAATATG
GATACCTCTGAGGAGACCGTTGCGGTCCGCAAGAAAGCTAAAGGTTCTGTCGAGCTGGAGGGTAATGTTTCGGAG
TTGTATTACAAGGTTCGGCGAGAGATTTACAACCTTCACGCGATGGTGGCCGCTTCATAA
Transcript >Agabi119p4|070310
ATGATCACCTTCACCCCTCTATCCGGAGCTGCTCGCTCAGATTCTCCGTCTCCCCTTTCATATCTCCTGCAGGTT
GATGATGTCCGAATGCTCCTCGATTGTGGCTCTCCGGATTGGGCACCCGAAAATGACGCTTCGACGGATGGTGAG
AATGAGAGCGAAGAGCCGCGACATTCCTGGTCGGACTATTGCGAGACCCTTCGTCGAATAGCACCTACTATTGAT
CTTGTCTTATTGTCCCATGGCGACCTATCACACTCGGGCCTGTATCCATATGCTTACTCGAGATGGGGTCTGAAG
GCACCGGCTTATTCGACGCTACCAGTACAAGCTACAGGGAAGATTGCTGCGATGGAAGACGTGGAAGGAATTCGC
GATGAACAGGATATTGGTGACGAGCCAATACAAGAGGCTGAACACCAAGAATTGCAGTCTGGAGAGGATGCTGGT
GTACACAAGGAATCCTCCCTGAATCCAACGACAAAAACGGGCAAATTTCTTGCTACTCTTGTGGAGGTGCAAGAT
GCTTTCGAATACCTCAATACACTTCGTTATTCTCAACCTATGCATCTCCAAGGGAAATGCCAGGGCATCACTATC
ACGCCTTTCAATGCTGGGCACACATTGGGAGGAACCATTTGGAAAATTCGGTCACCAACGTCTGGAACTATCATA
TACGCTGTACACATGAATCACATGAAAGAGCGGCATTTGGACGGGACCGTTCTAATGAAAAATGCTAGTGGTGGA
ATATTCGAACCTCTAGCGCGGCCAGATTTGCTCATCACGGATGCTGACCGAGCCAATGTTATAACAAGTCGGCGA
AAAGACAGGGATGCCGCTCTCATCGATACCATCACTGCGACTCTCTCATCCCGGTCATCTCTACTTCTCCCCTGT
GATTCCAGCACCCGGATCCTTGAACTTCTGGTGTTACTAGATCAACATTGGAGCTATTCACGACTGCGATATCCA
ATCTGCCTTCTCGCACGAACAGGGAGAGATATGCTTGCTTTCGTTCGGAGTATGATGGAATGGCTAGGTGGTACG
ATAAGCAAAGAAGACGTTGGAGTAGAAGCCACTGCCAAGCAACGGAACAAACGAAAGAGAGATGATGATGATGAT
AACGAAGCACTTGGTGCTCTGGCTTTACGATTCAAACACCTAGAGTTTTTCCCCAACCCCCAGGCTCTTCTACAG
ACATATTCTTCAAAGGACCCCAAGTTAATCCTTGCGGTTCCCGCTTCTTTATCTCACGGGCCCTCGAGGAACCTC
TTTGTAGATTTTGCTGTCGTTCCGGACAATGTCGTTCTACTCACAGGCCGAGGGGAGGAGGGATCACTTGGTCGA
GCACTCTTTAATAAGTGGAATGACAGACAACGTGTAGATGACAAGTGGGACAAAGGCAAGATCGGTAGCAATATC
ATGTTAGATGGTGGATTTCGCATGAAGATGCGTAGCAAAGTGCCGTTGCAAGGCGCCGAACTAGAAGCTTATCTC
CAACAAGAGAAGGAGAAAAAGGATAAAGAAGTAGCTCAGCAAGCTGCACTCGCACGTAGTCAGCGTATGCTTGAA
GCTGATGAGGATGAAAGTGATTCAGACTCGGATACTGACGAAGAAGAAGAGGTAAGGAGGACCTTAGAAGGTGAC
ATGGAGGTTGATGGTGACGGAATATCGCGACGGCGCAAAAGAGATGATACGGATGCAACTGACTGGGCTCTAGAT
GCGGATGAGGGCTTGACGAAACAATTCCTTTCTTTTGATATTTACCTGAAGGGAAATGTGTCAAGAGCTACCTCA
TTTTTCAAGACTGCAGGTGGGCAGACCCAGCGTTTCCGTATGTTCCCATACGTCGAAAAGAAAAGAAGAGTAGAC
GAGTATGGTGAAACAATAGATGTGGGTATGTGGTTGAGGAAGGGAATGGTGCTAGAGGAGGAGGCGGAGAGTGAC
GAAATCAAAGATTATAAGAAAAAGCTCCAAGAAGAGGAAGAAGCCAAGAAAATAAAAGAGCCCCCGTCCAAATTT
GTGACAATGGACGTCGATGTCCAATTAGCTTGTCGACTACTTTTTGTTGACATGGAGGGACTCAATGATGGGCGA
GCCGTAAAAACGATTGTCCCACAAATCAATCCGCGGAAGATGATTCTGGTTTCTGCTTCAGAATCGGCGTCGAAC
GCCCTCATCGAAAGTTGTAGCAATATCCGCGCCATGACGAAGGATATCTATTCTCCCGCTGTAGGCGAGAGCGTT
CAGATCGGCCAACAGACAAACACGTTCTCAATTTCGATCAGTGAAGATCTCCTTACCTCTCTCAGGATGTCCCGG
TTTGAAGATAATGAGATAGGTTATGTGAGGGGCCGAGTTGTCGCCCATGCAACCTCGACAATTCCGACGCTCGAG
TCTGTCTCTTCGCTCCCACCCACCACTGATCGCACTGTTGTCAGTGATCCTTCAAAAAGCCGCATACTTGGCTCG
CGTCCGAAGGTTGCACTGCCTCAGTCAACTATGATTGGGGAACTTAAACTAACCGCGTTGAAACAACGGTTGGCT
GCCGTTAATATTCCCGCTGAATTGATTGGAGAAGGTGTTTTGATCTGTGGAGGCATCAGACAAACTGACAATATG
GATACCTCTGAGGAGACCGTTGCGGTCCGCAAGAAAGCTAAAGGTTCTGTCGAGCTGGAGGGTAATGTTTCGGAG
TTGTATTACAAGGTTCGGCGAGAGATTTACAACCTTCACGCGATGGTGGCCGCTTCATAA
Gene >Agabi119p4|070310
ATGATCACCTTCACCCCTCTATCCGGAGCTGCTCGCTCAGATTCTCCGTCTCCCCTTTCATATCTCCTGCAGGTT
GATGATGTCCGAATGCTCCTCGATTGTGGCTCTCCGGATTGGGCACCCGAAAATGACGCTTCGACGGATGGTGAG
AATGAGAGCGAAGAGCCGCGACATTCCTGGTCGGACTATTGCGAGACCCTTCGTCGGTCGGTACTATTTGTCTTC
ATTGCTGTCCTCTGTTCATATATGCCTTTTTCCAAAATGTAGAATAGCACCTACTATTGATCTTGTCTTATTGTC
CCATGGCGACCTATCACACTCGGGCCTGTATCCATATGCTTACTCGAGATGGGGTCTGAAGGCACCGGCTTATTC
GACGCTACCAGTACAAGCTACAGGGAAGATTGCTGCGATGGAAGACGTGGAAGGAATTCGCGATGAACAGGATAT
TGGTGACGAGCCAATACAAGAGGCTGAACACCAAGAATTGCAGTCTGGAGAGGATGCTGGTGTACACAAGGAATC
CTCCCTGAATCCAACGACAAAAACGGGCAAATTTCTTGCTACTCTTGTGGAGGTGCAAGATGCTTTCGAATACCT
CAATACACTTCGTTATTCTCAACCTATGCATCTCCAAGGTCAGACTCAATGTTCCTTGCCCAACAATACTCTCAA
TGACAGCTTCGTGTAGGGAAATGCCAGGGCATCACTATCACGCCTTTCAATGCTGGGCACACATTGGGAGGAACC
ATTTGGAAAATTCGGTCACCAACGTCTGGAACTATCATATACGCTGTACACATGAATCACATGAAAGAGCGGCAT
TTGGACGGGACCGTTCTAATGAAAAATGCTAGTGGTGGAATATTCGAACCTCTAGCGCGGCCAGATTTGCTCATC
ACGGATGCTGACCGAGCCAATGTTATAACAAGTCGGCGAAAAGACAGGGATGCCGCTCTCATCGGTGCGTCTTCT
GTCTGAGAATTAAAAAAAGTATACTTGACCTAATGTTTACTCCCTAGATACCATCACTGCGACTCTCTCATCCCG
GTCATCTCTACTTCTCCCCTGTGATTCCAGCACCCGGATCCTTGAACTTCTGGTGTTACTAGATCAACATTGGAG
CTATTCACGACTGCGATATCCAATCTGCCTTCTCGCACGAACAGGGAGAGATATGCTTGCTTTCGTTCGGAGTAT
GATGGAATGGCTAGGTGGTACGATAAGCAAAGAAGACGTTGGAGTAGAAGCCACTGCCAAGCAACGGAACAAACG
AAAGAGAGATGATGATGATGATAACGAAGCACTTGGTGCTCTGGCTTTACGATTCAAGTAAGACTATCCTGAACT
ATCGGTCTAATGTGACCTCAACTATATTTAGACACCTAGAGTTTTTCCCCAACCCCCAGGCTCTTCTACAGACAT
ATTCTTCAAAGGACCCCAAGTTAATCCTTGCGGTTCCCGCTTCTTTATCTCACGGGCCCTCGAGGAACCTCTTTG
TAGATTTTGCTGTCGTTCCGGACAATGTCGTTCTACTCACAGGCCGAGGGGAGGAGGGATCACTTGGTCGAGCAC
TCTTTAATAAGTGGAATGACAGACAACGTGTAGATGACAAGTGGGACAAAGGCAAGATCGGTAGCAATATCATGT
TAGATGGTGGATTTCGCATGAAGGTGAGCGGACTGAAGCTTTCAAGGTATCTGGCTCTGAACCTCTTGGAACAAG
ATGCGTAGCAAAGTGCCGTTGCAAGGCGCCGAACTAGAAGCTTATCTCCAACAAGAGAAGGAGAAAAAGGATAAA
GAAGTAGCTCAGCAAGCTGCACTCGCACGTAGTCAGCGTATGCTTGAAGCTGATGAGGATGAAAGTGATTCAGAC
TCGGATACTGACGAAGAAGAAGAGGTAAGGAGGACCTTAGAAGGTGACATGGAGGTTGATGGTGACGGAATATCG
CGACGGCGCAAAAGAGATGATACGGATGCAACTGACTGGGCTCTAGATGCGGATGAGGGCTTGACGAAACAATTC
CTTTCTTTTGATATTTACCTGAAGGGAAATGTGTCAAGAGCTACCTCATTTTTCAAGACTGCAGGTGGGCAGACC
CAGCGTTTCCGTATGTTCCCATACGTCGAAAAGAAAAGAAGAGTAGACGAGTATGGTGAAACAATAGATGTGGGT
ATGTGGTTGAGGAAGGGAATGGTGCTAGAGGAGGAGGCGGAGAGTGACGAAATCAAAGATTATAAGAAAAAGCTC
CAAGAAGAGGAAGAAGCCAAGGTGTGCATGTCGTCTTTGCTTTGCTAAGGATTTCATCTAAAAAAAAATAACATG
GCCACAGAAAATAAAAGAGCCCCCGTCCAAATTTGTGACAATGGACGTCGATGTCCAATTAGCTTGTCGACTACT
TTTTGTTGACATGGAGGGACTCAATGATGGGCGAGCCGTAAAAACGATTGTCCCACAAATCAATCCGCGGAAGAT
GGTTGGTATTCACAAGACAGACTCATGCGTCATTATTCTGAATAAAGACACAGATTCTGGTTTCTGCTTCAGAAT
CGGCGTCGAACGCCCTCATCGAAAGTTGTAGCAATATCCGCGCCATGACGAAGGATATCTATTCTCCCGCTGTAG
GCGAGAGCGTTCAGATCGGCCAACAGACAAACACGTTCTCAATTTCGATCAGTGAAGATCTCCTTACCTCTCTCA
GGATGTCCCGGGTGAGCCTTTAATTATCTTATTACCCAGCGGATTTCACTCAATACCAAAGGTTCCAGTTTGAAG
ATAATGAGATAGGTTATGTGAGGGGCCGAGTTGTCGCCCATGCAACCTCGACAATTCCGACGCTCGAGTCTGTCT
CTTCGCTCCCACCCACCACTGATCGCACTGTTGTCAGTGATCCTTCAAAAAGCCGCATACTTGGCTCGCGTCCGA
AGGTTGCACTGCCTCAGTCAACTATGATTGGGGAACTTAAACTAACCGCGTTGAAACAACGGTTGGCTGCCGTTA
ATATTCCCGCTGAATTGATTGGAGAAGGTGTTTTGATCTGTGGAGGCATCAGACAAACTGACAATATGGATACCT
CTGAGGAGACCGTTGCGGTCCGCAAGAAAGCTAAAGGTTCTGTCGAGCTGGAGGGTAATGTTTCGGAGTTGTATT
ACAAGGTTCGGCGAGAGATTTACAACCTTCACGCGATGGTGGCCGCTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail