Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|069890
Gene name
Locationscaffold_04:1059744..1060216
Strand+
Gene length (bp)472
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D6RMH5|LCL2_COPC7 Long chronological lifespan protein 2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LCL2 PE=3 SV=1 11 137 4.0E-34
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 11 134 3.0E-11
sp|B8M9Q9|LCL2_TALSN Long chronological lifespan protein 2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=lcl2 PE=3 SV=1 14 134 8.0E-11
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 11 134 1.0E-10
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 11 134 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D6RMH5|LCL2_COPC7 Long chronological lifespan protein 2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LCL2 PE=3 SV=1 11 137 4.0E-34
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 11 134 3.0E-11
sp|B8M9Q9|LCL2_TALSN Long chronological lifespan protein 2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=lcl2 PE=3 SV=1 14 134 8.0E-11
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 11 134 1.0E-10
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 11 134 1.0E-10
sp|A1CZR3|LCL2_NEOFI Long chronological lifespan protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl2 PE=3 SV=1 11 134 2.0E-10
sp|E6R3N7|LCL2_CRYGW Long chronological lifespan protein 2 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=LCL2 PE=3 SV=1 76 134 2.0E-10
sp|A1C4T4|LCL2_ASPCL Long chronological lifespan protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl2 PE=3 SV=1 12 134 4.0E-10
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 9 134 5.0E-10
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 9 134 5.0E-10
sp|B9WM02|LCL2_CANDC Long chronological lifespan protein 2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL2 PE=3 SV=1 17 107 3.0E-08
sp|Q59PT4|LCL2_CANAL Long chronological lifespan protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL2 PE=3 SV=1 17 107 5.0E-08
sp|C4YM26|LCL2_CANAW Long chronological lifespan protein 2 OS=Candida albicans (strain WO-1) GN=LCL2 PE=3 SV=1 17 107 5.0E-08
sp|A2QUM3|LCL2_ASPNC Long chronological lifespan protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl2 PE=3 SV=1 10 134 7.0E-08
sp|Q0UAF6|LCL2_PHANO Long chronological lifespan protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL2 PE=3 SV=1 48 119 1.0E-07
sp|C4R2P5|LCL2_PICPG Long chronological lifespan protein 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL2 PE=3 SV=1 15 134 2.0E-07
sp|B6HU36|LCL2_PENRW Long chronological lifespan protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl2 PE=3 SV=1 11 134 3.0E-07
sp|C5FVJ9|LCL2_ARTOC Long chronological lifespan protein 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL2 PE=3 SV=1 13 134 4.0E-07
sp|C0S855|LCL2_PARBP Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL2 PE=3 SV=1 54 134 2.0E-06
sp|C1H0A6|LCL2_PARBA Long chronological lifespan protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL2 PE=3 SV=1 54 134 2.0E-06
sp|C1GJL9|LCL2_PARBD Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL2 PE=3 SV=1 54 134 2.0E-06
sp|A5DP59|LCL2_PICGU Long chronological lifespan protein 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL2 PE=3 SV=1 15 107 5.0E-06
sp|C4YAT5|LCL2_CLAL4 Long chronological lifespan protein 2 OS=Clavispora lusitaniae (strain ATCC 42720) GN=LCL2 PE=3 SV=1 13 109 6.0E-06
sp|B6QFV5|LCL2_TALMQ Long chronological lifespan protein 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lcl2 PE=3 SV=1 14 134 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|069890
MRQHSPSPFYSWLLMAVFLLLQIHVASANYEQLYNLFHGHGGGHQQQQQQQQHHHHQQQRTGASQFSAYADSVAC
AHYLCPQTLDCVELPSNCPCPNVEDIKCLIPDMDGDVDDATVVCVRGNQECKEVERLMKKYSQ*
Coding >Agabi119p4|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCATGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCAGCAGCAGCAGCAACAA
CAACAACATCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGTTGCATGT
GCTCACTACCTTTGTCCACAAACGTTGGACTGCGTGGAGCTACCCTCGAATTGCCCATGTCCTAATGTTGAGGAT
ATCAAATGTCTTATCCCAGACATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAACCAAGAG
TGCAAAGAGGTGGAAAGGCTGATGAAAAAATACTCTCAATGA
Transcript >Agabi119p4|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCATGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCAGCAGCAGCAGCAACAA
CAACAACATCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGTTGCATGT
GCTCACTACCTTTGTCCACAAACGTTGGACTGCGTGGAGCTACCCTCGAATTGCCCATGTCCTAATGTTGAGGAT
ATCAAATGTCTTATCCCAGACATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAACCAAGAG
TGCAAAGAGGTGGAAAGGCTGATGAAAAAATACTCTCAATGA
Gene >Agabi119p4|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCATGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCAGCAGCAGCAGCAACAA
CAACAACATCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGGTGGGTCG
TCATATCCATATTTTAAGCATCTATTGGTAATGAACAATTCTTATAGTTGCATGTGCTCACTACCTTTGTCCACA
AACGTTGGACTGCGTGGAGCTACCCTCGAATTGCCCATGTCCTAATGTTGAGGATATCAAATGTCTTATCCCAGA
CATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAACCAAGAGTGCAAAGAGGTGGAAAGGCT
GATGAAAAAATACTCTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail