Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|069520
Gene name
Locationscaffold_04:2735494..2736256
Strand-
Gene length (bp)762
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08617 CGI-121 Kinase binding protein CGI-121 1.5E-50 21 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM65|CG121_CRYNB EKC/KEOPS complex subunit CGI121 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CGI121 PE=3 SV=1 1 201 7.0E-28
sp|P0CM64|CG121_CRYNJ EKC/KEOPS complex subunit CGI121 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CGI121 PE=3 SV=1 1 201 7.0E-28
sp|Q4WI37|CG121_ASPFU EKC/KEOPS complex subunit cgi121 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cgi121 PE=3 SV=1 6 168 3.0E-27
sp|A1CEY5|CG121_ASPCL EKC/KEOPS complex subunit cgi121 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cgi121 PE=3 SV=1 1 169 3.0E-25
sp|Q0C9R3|CG121_ASPTN EKC/KEOPS complex subunit cgi121 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cgi121 PE=3 SV=2 8 168 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM65|CG121_CRYNB EKC/KEOPS complex subunit CGI121 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CGI121 PE=3 SV=1 1 201 7.0E-28
sp|P0CM64|CG121_CRYNJ EKC/KEOPS complex subunit CGI121 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CGI121 PE=3 SV=1 1 201 7.0E-28
sp|Q4WI37|CG121_ASPFU EKC/KEOPS complex subunit cgi121 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cgi121 PE=3 SV=1 6 168 3.0E-27
sp|A1CEY5|CG121_ASPCL EKC/KEOPS complex subunit cgi121 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cgi121 PE=3 SV=1 1 169 3.0E-25
sp|Q0C9R3|CG121_ASPTN EKC/KEOPS complex subunit cgi121 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cgi121 PE=3 SV=2 8 168 1.0E-22
sp|Q7SHG9|CG121_NEUCR EKC/KEOPS complex subunit cgi121 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cgi121 PE=3 SV=1 8 200 7.0E-22
sp|Q03705|CG121_YEAST EKC/KEOPS complex subunit CGI121 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CGI121 PE=1 SV=1 7 190 3.0E-21
sp|Q6CT72|CG121_KLULA EKC/KEOPS complex subunit CGI121 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CGI121 PE=3 SV=1 15 150 8.0E-21
sp|Q4ID21|CG121_GIBZE EKC/KEOPS complex subunit CGI121 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CGI121 PE=3 SV=1 8 200 1.0E-20
sp|Q8QZZ7|TPRKB_MOUSE EKC/KEOPS complex subunit Tprkb OS=Mus musculus GN=Tprkb PE=1 SV=1 1 169 2.0E-19
sp|Q1DYR7|CG121_COCIM EKC/KEOPS complex subunit CGI121 OS=Coccidioides immitis (strain RS) GN=CGI121 PE=3 SV=1 5 169 5.0E-19
sp|Q6FV72|CG121_CANGA EKC/KEOPS complex subunit CGI121 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CGI121 PE=3 SV=1 4 171 3.0E-18
sp|Q6C7C9|CG121_YARLI EKC/KEOPS complex subunit CGI121 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CGI121 PE=3 SV=1 6 173 6.0E-18
sp|Q9P7J3|CG121_SCHPO EKC/KEOPS complex subunit cgi121 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgi121 PE=3 SV=1 6 167 9.0E-18
sp|Q4P144|CG121_USTMA EKC/KEOPS complex subunit CGI121 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CGI121 PE=3 SV=1 9 202 5.0E-17
sp|Q5PQR8|TPRKB_RAT EKC/KEOPS complex subunit Tprkb OS=Rattus norvegicus GN=Tprkb PE=2 SV=1 1 163 2.0E-16
sp|Q0UEM3|CG121_PHANO EKC/KEOPS complex subunit CGI121 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CGI121 PE=3 SV=2 4 199 1.0E-15
sp|Q75D21|CG121_ASHGO EKC/KEOPS complex subunit CGI121 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CGI121 PE=3 SV=2 7 167 2.0E-14
sp|Q5A519|CG121_CANAL EKC/KEOPS complex subunit CGI121 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGI121 PE=3 SV=1 6 181 2.0E-14
sp|Q9Y3C4|TPRKB_HUMAN EKC/KEOPS complex subunit TPRKB OS=Homo sapiens GN=TPRKB PE=1 SV=1 1 169 4.0E-14
sp|Q6BP94|CG121_DEBHA EKC/KEOPS complex subunit CGI121 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CGI121 PE=3 SV=1 53 134 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|069520
MDLFYFPHLPSDRATTHIALFKNVTNSAALRKRIINASTMEGEGGDFEREQVNFAFIDARLITSRLHLQTAVYQS
ILAESENSLRTKTVHSEVLWNLNPTNNITEAIRRYGVSDTATSLLVIRIDAGTLPADEIEAKMRNIVDGDLVPFS
YLDEITDWSLIKKHHKLANDLAIKNVQGDVEQEKAIVDKIVTSIVAMKSVMA*
Coding >Agabi119p4|069520
ATGGACCTTTTCTATTTTCCACATCTTCCCTCGGATCGAGCTACGACTCATATTGCTCTGTTCAAAAATGTAACT
AATTCTGCTGCACTAAGAAAACGAATCATCAATGCCTCAACAATGGAGGGGGAGGGTGGCGATTTCGAACGCGAA
CAAGTCAACTTTGCTTTTATTGATGCACGGCTTATAACAAGCCGACTTCATTTGCAAACGGCTGTTTATCAGTCA
ATTCTAGCGGAAAGTGAAAATTCACTACGAACAAAGACCGTTCACTCCGAGGTTCTTTGGAATTTAAACCCGACA
AACAACATCACTGAAGCTATTCGACGGTACGGCGTATCTGATACCGCAACTTCCTTGCTAGTCATCCGCATCGAT
GCTGGTACTCTACCTGCGGACGAGATTGAAGCTAAAATGAGAAACATCGTTGACGGAGACCTCGTCCCTTTCTCA
TACCTGGATGAAATAACAGATTGGTCATTAATCAAAAAGCATCACAAACTGGCTAATGATCTCGCTATCAAAAAC
GTACAAGGAGACGTAGAACAGGAAAAGGCGATCGTTGATAAAATTGTCACAAGTATCGTTGCAATGAAAAGTGTC
ATGGCTTGA
Transcript >Agabi119p4|069520
ATGGACCTTTTCTATTTTCCACATCTTCCCTCGGATCGAGCTACGACTCATATTGCTCTGTTCAAAAATGTAACT
AATTCTGCTGCACTAAGAAAACGAATCATCAATGCCTCAACAATGGAGGGGGAGGGTGGCGATTTCGAACGCGAA
CAAGTCAACTTTGCTTTTATTGATGCACGGCTTATAACAAGCCGACTTCATTTGCAAACGGCTGTTTATCAGTCA
ATTCTAGCGGAAAGTGAAAATTCACTACGAACAAAGACCGTTCACTCCGAGGTTCTTTGGAATTTAAACCCGACA
AACAACATCACTGAAGCTATTCGACGGTACGGCGTATCTGATACCGCAACTTCCTTGCTAGTCATCCGCATCGAT
GCTGGTACTCTACCTGCGGACGAGATTGAAGCTAAAATGAGAAACATCGTTGACGGAGACCTCGTCCCTTTCTCA
TACCTGGATGAAATAACAGATTGGTCATTAATCAAAAAGCATCACAAACTGGCTAATGATCTCGCTATCAAAAAC
GTACAAGGAGACGTAGAACAGGAAAAGGCGATCGTTGATAAAATTGTCACAAGTATCGTTGCAATGAAAAGTGTC
ATGGCTTGA
Gene >Agabi119p4|069520
ATGGACCTTTTCTATTTTCCACATCTTCCCTCGGATCGAGCTACGACTCATATTGCTCTGTTCAAAAATGTAACT
AATTCTGCTGCACTAAGAAAACGAATCATCAATGCCTCAACAATGGAGGGGGAGGGTGGCGATTTCGAACGCGAA
CAAGTCAACTTTGCTTTTATTGATGCACGGCTTGTCAGTTCTTCTGTAACTTGTTCTGGGTAAAGGTGATTACCA
TCTACCAATAGATAACAAGCCGACTTCATTTGCAAACGGCTGTTTATCAGTCAATTCTAGCGGAAAGTGAAAATT
CACTACGAACAAAGACCGTTCACTCCGAGGTTCTTTGGAATTTAAACCCGACAAACAACGTATGTAAGCTACATT
TTTGTGAAACTAATTAATCTTTCAGTTATCTAGATCACTGAAGCTATTCGACGGTACGGCGTATCTGATACCGCA
ACTTCCTTGCTAGTCATCCGCATCGATGCTGGTACTCTACCTGCGGACGAGATTGAAGCTAAAATGAGAAACATC
GTTGACGGAGACCTCGTCCCTTTCTCATACCTGGATGAAATAACAGATTGGTCATTAATCAAAAAGGTTTGCAGA
GTAAATCATACATGTGTTGCGGCGGATAACCTGCATCTATAGCATCACAAACTGGCTAATGATCTCGCTATCAAA
AACGTACAAGGAGACGTAGAACAGGAAAAGGCGATCGTTGATAAAATTGTCACAAGTATCGTTGCAATGAAAAGT
GTCATGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail