Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|069360
Gene name
Locationscaffold_04:2775153..2776434
Strand-
Gene length (bp)1281
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 7.4E-07 8 86

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|069360
MTPLKINVLLLGSTGFLGSTFLKLIGQDSDLKDRLHITVLCRNSAKRFTELQKFYSDLEVVECNLEDDAVIQDHA
AKTDIVINAASSDHVESIKSTLRGLEKNSAANPNKPPMYLQVSGLGITSDNSHGEYVNIDDLPGYVDIDFSLDQV
PQENTHLPQDKLIVEAGTRTKNPVRTAIVFPGWIYGVGEAIQQTTLPVRIWVDMFLRAGYAGTWGEGHSIMGNAH
VKDVASALATVLKAMLDGKADEGAKGFYFAISRQRMVSNREIASKIGDILFEHGLAKKGGSRPYPPEIVEPLGFY
GWSLLGANQMAHAHHLSRFGWKPTETKKVLLMESLREEVLMYLRQLGKIPA*
Coding >Agabi119p4|069360
ATGACTCCATTAAAAATCAACGTTCTCTTACTTGGCTCTACTGGCTTCCTCGGCTCTACATTCCTCAAGCTAATC
GGTCAGGACTCGGACCTAAAGGATAGACTCCATATCACTGTCCTTTGCCGAAACAGTGCCAAGCGTTTCACTGAA
CTTCAAAAATTTTATTCCGATCTCGAAGTGGTTGAATGCAATCTCGAAGACGATGCTGTCATCCAAGACCACGCT
GCCAAAACAGATATTGTTATCAACGCAGCAAGCAGCGACCATGTTGAGAGCATCAAATCGACTCTACGGGGTCTT
GAAAAGAATTCTGCCGCCAATCCCAACAAGCCCCCAATGTACCTCCAAGTTTCTGGTCTTGGTATCACATCCGAC
AATTCCCATGGCGAATATGTCAACATCGACGACTTACCTGGATACGTCGATATCGATTTCAGCCTTGATCAAGTA
CCTCAGGAAAACACTCACTTGCCTCAAGATAAACTCATCGTAGAAGCTGGGACGCGTACAAAAAATCCCGTTCGC
ACGGCTATTGTATTTCCCGGTTGGATTTATGGCGTTGGCGAAGCGATCCAACAGACTACACTTCCGGTTCGGATT
TGGGTTGATATGTTCCTGAGGGCTGGATACGCCGGAACTTGGGGGGAAGGCCATAGCATTATGGGCAATGCCCAT
GTGAAGGATGTCGCATCTGCTTTAGCTACGGTCCTCAAAGCTATGCTGGATGGTAAGGCTGACGAAGGTGCTAAA
GGATTCTATTTCGCCATTAGCAGACAGCGTATGGTCAGTAACCGAGAAATTGCTTCCAAGATCGGTGATATCCTA
TTTGAACATGGTCTGGCTAAAAAGGGCGGCAGTCGTCCATATCCCCCCGAAATAGTTGAGCCTCTGGGTTTTTAT
GGTTGGTCTCTCCTCGGCGCCAACCAAATGGCACACGCGCATCACCTTAGTAGGTTTGGCTGGAAGCCAACTGAG
ACGAAGAAGGTATTGTTGATGGAGTCCCTTCGAGAGGAAGTGTTGATGTATCTTCGTCAACTTGGAAAGATTCCG
GCTTGA
Transcript >Agabi119p4|069360
ATGACTCCATTAAAAATCAACGTTCTCTTACTTGGCTCTACTGGCTTCCTCGGCTCTACATTCCTCAAGCTAATC
GGTCAGGACTCGGACCTAAAGGATAGACTCCATATCACTGTCCTTTGCCGAAACAGTGCCAAGCGTTTCACTGAA
CTTCAAAAATTTTATTCCGATCTCGAAGTGGTTGAATGCAATCTCGAAGACGATGCTGTCATCCAAGACCACGCT
GCCAAAACAGATATTGTTATCAACGCAGCAAGCAGCGACCATGTTGAGAGCATCAAATCGACTCTACGGGGTCTT
GAAAAGAATTCTGCCGCCAATCCCAACAAGCCCCCAATGTACCTCCAAGTTTCTGGTCTTGGTATCACATCCGAC
AATTCCCATGGCGAATATGTCAACATCGACGACTTACCTGGATACGTCGATATCGATTTCAGCCTTGATCAAGTA
CCTCAGGAAAACACTCACTTGCCTCAAGATAAACTCATCGTAGAAGCTGGGACGCGTACAAAAAATCCCGTTCGC
ACGGCTATTGTATTTCCCGGTTGGATTTATGGCGTTGGCGAAGCGATCCAACAGACTACACTTCCGGTTCGGATT
TGGGTTGATATGTTCCTGAGGGCTGGATACGCCGGAACTTGGGGGGAAGGCCATAGCATTATGGGCAATGCCCAT
GTGAAGGATGTCGCATCTGCTTTAGCTACGGTCCTCAAAGCTATGCTGGATGGTAAGGCTGACGAAGGTGCTAAA
GGATTCTATTTCGCCATTAGCAGACAGCGTATGGTCAGTAACCGAGAAATTGCTTCCAAGATCGGTGATATCCTA
TTTGAACATGGTCTGGCTAAAAAGGGCGGCAGTCGTCCATATCCCCCCGAAATAGTTGAGCCTCTGGGTTTTTAT
GGTTGGTCTCTCCTCGGCGCCAACCAAATGGCACACGCGCATCACCTTAGTAGGTTTGGCTGGAAGCCAACTGAG
ACGAAGAAGGTATTGTTGATGGAGTCCCTTCGAGAGGAAGTGTTGATGTATCTTCGTCAACTTGGAAAGATTCCG
GCTTGA
Gene >Agabi119p4|069360
ATGACTCCATTAAAAATCAACGTTCTCTTACTTGGCTCTACTGGCTTCCTCGGCTCTACATTCCTCAAGCTAATC
GGTCAGGACTCGGACCTAAAGGATAGACTCCATATCACTGTCCTTTGCCGAAACAGTGCCAAGCGTTTCACTGAA
CTTCAAAAATTTTATTCCGATCTCGAAGTGGTTGAATGCAATCTCGAAGACGATGCTGTCATCCAAGACCACGCT
GCCAAAACAGATATTGTTATCAACGCAGCAAGCAGCGACCATGTTGAGAGCATCAAATGTTCGCTCTTTGTTTCT
TTGTACTTGCCGCTGAACACCCATCTTAGACTCTTACAGCGACTCTACGGGGTCTTGAAAAGAATTCTGCCGCCA
ATCCCAACAAGCCCCCAATGTACCTCCAAGTTTCTGGTCTTGGTATCACATCCGACAATTCCCATGGCGAATATG
TCAACATCGACGACTTACCTGGATACGTCGATATCGATTTCAGCCTTGATCAAGTACCTCAGGAAAACACTCACT
TGCCTCAAGATAAACTCATCGTAGAAGCTGGGACGCGTACAAAAAATCCCGTTCGCACGGCTATTGTATTTCCCG
GTTGGATTTATGGCGTTGGCGAAGCGATCCAACAGACTACACTTCCGGTTCGGATTTGGGTTGATATGTTCCTGA
GGGCTGGATACGCCGGAACTTGGGGGGAAGGCCATAGCATTATGGGCAATGCCCATGTGAAGGATGTCGCATCTG
CTTTAGCTACGGTCCTCAAAGCTATGCTGGATGGTAAGGCTGACGAAGGTGCTAAAGGATTCTGTGCGTTCTTTC
TGATAATACTTTCAAGATCTCAACTGACGTACACATAGATTTCGCCATTAGCAGACAGCGTATGGTCAGTAACCG
AGAAATTGCTTCCAAGATCGGTGATGTCAGTCACACACTTATCAGATGTGTCTGATGAATATTGACCGGCTAGTC
ATGCTTTAGATCCTATTTGAACATGGTCTGGCTAAAAAGGGCGGCAGTCGTCCATATCCCCCCGAAATAGTTGAG
CCTCTGGGTTTTTGTACGTTTTCTTTCCGGCTATCAATTAAGCACTATTCTGAGAATTATCTCCGGATACAAGAT
GGTTGGTCTCTCCTCGGCGCCAACCAAATGGCACACGCGCATCACCTTAGTAGGTTTGGCTGGAAGCCAACTGAG
ACGAAGAAGGTATTGTTGATGGAGTCCCTTCGAGAGGAAGTGTTGATGTATCTTCGTCAACTTGGAAAGATTCCG
GCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail