Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|069320
Gene name
Locationscaffold_04:2785591..2788895
Strand+
Gene length (bp)3304
Transcript length (bp)2865
Coding sequence length (bp)2865
Protein length (aa) 955

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 8.7E-78 71 313
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 2.9E-67 549 740
PF02815 MIR MIR domain 3.8E-39 360 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 60 831 0.0E+00
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 64 792 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 60 744 6.0E-174
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 74 743 7.0E-137
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 78 743 8.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 60 831 0.0E+00
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 64 792 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 60 744 6.0E-174
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 74 743 7.0E-137
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 78 743 8.0E-136
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 67 742 7.0E-134
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 38 742 7.0E-133
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 67 761 1.0E-132
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 67 742 3.0E-131
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 79 740 9.0E-130
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 68 742 6.0E-129
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 72 747 1.0E-124
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 79 737 1.0E-123
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 70 723 1.0E-120
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 18 741 4.0E-114
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 69 743 3.0E-110
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 33 742 2.0E-106
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 69 740 3.0E-106
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 68 742 7.0E-103
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 68 742 8.0E-103
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 81 742 2.0E-101
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 36 742 3.0E-92
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 71 742 8.0E-91
sp|Q06644|PMT7_YEAST Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT7 PE=1 SV=1 141 531 4.0E-30
sp|Q3SZ45|SDF2_BOVIN Stromal cell-derived factor 2 OS=Bos taurus GN=SDF2 PE=2 SV=1 361 492 1.0E-06
sp|Q99470|SDF2_HUMAN Stromal cell-derived factor 2 OS=Homo sapiens GN=SDF2 PE=1 SV=2 361 492 1.0E-06
sp|Q9DCT5|SDF2_MOUSE Stromal cell-derived factor 2 OS=Mus musculus GN=Sdf2 PE=1 SV=1 337 492 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0016020 membrane Yes
GO:0043413 macromolecule glycosylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0070085 glycosylation No
GO:0016757 glycosyltransferase activity No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0036211 protein modification process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 148 170 22
3 200 219 19
4 234 256 22
5 291 313 22
6 605 624 19
7 645 664 19
8 668 687 19
9 700 722 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|069320
MAANVRFRRPASPPPGIAYAGQTRFPQPRQHYDADEKRAAASKGFGPRRTKSYPSGGLNLTMGELKLLFLVVLIA
CGVRLFRLSKPHSVVFDEVHFGKFASKYIKSQYFVDVHPPLAKLLITFAGFAFGYNGHFDFKDIGKMYENVPYVA
MRMVPATLGVATVPLAYLTLRALDCRATTALLASLFITFENGLVTQSRHILLDSPLIFFTALTVFFWTGFTNEDK
HEPFTTNWWTWLVLSGLSLGAVVSCKWVGLFTIATIGVSTIWQLWNLLGDLRVAPRLFIRHFMARAICLIALPII
FYMLMFQIHFLILENSGDGDGFMSSEFQHTLKGRGMADTFADVSVYSTVTIRHVNTQGGYLHSHPHAYPGGSKQQ
QITLYPHRDHNNEWQIANATVISDYDPASLVHITPNMRVKLLHTATGKRLHSHDVRPPVSDVDFQNEVSGYGVPG
YDGDANDDWIVEIDDGDSRDTESYKRLRTLRTKFRLKHPMTGCYLFSHKVKLPDWGFEQQEVTCNKNAVHDNSLW
YIETSEHVNNSPNAPKVNYKLPGFFGKFFELQRVMWTTNAGLTDRHTFDSRPDSWPLLRRGINFWVKDHKQIYLM
GNPMIWWSSTLAVVLYALVRGFLVLRQKRGFRDFDNTKVVKYNTLCSFLFIGWALHYFPFFLMARQLFLHHYFPA
LYFAILLYCSVFDLVTSTLRPRVRLYAAGILVVLAIWNFQHFAPLAYGTEWTRAQCENSKWMKTWDFSCVDFYDE
YSQYHGSQGTGLKETLAVTPENGAPIVVDPLVAQAGIHQDPPNHHNQQEQGKAADLEQEHTTIDPGRPEPGRNIF
AGDGENEKAKSDNIGVPSDEGDAKKEISSVNVPAPTTEIKVEGKEGLKGEKEDDRGTQSTEGEGKVTMAMAADGA
TEGKKTPETEKEAEEAEQGAADGKKDRPLVGPHDEAGEEAERVAEELFGDDSDE*
Coding >Agabi119p4|069320
ATGGCTGCCAATGTTCGATTCCGGCGACCAGCATCTCCACCTCCAGGCATCGCATATGCTGGTCAGACTAGGTTT
CCACAGCCAAGACAACATTACGACGCCGACGAAAAACGAGCAGCAGCCTCCAAAGGCTTCGGCCCAAGAAGAACT
AAATCCTATCCTTCGGGAGGTCTTAACCTGACAATGGGAGAGCTCAAATTGTTGTTCCTAGTTGTTCTAATTGCT
TGCGGTGTCCGGTTGTTTAGACTTTCGAAACCTCACAGCGTTGTTTTCGACGAGGTACATTTCGGAAAGTTTGCT
TCGAAATACATCAAGAGCCAGTATTTTGTTGATGTCCACCCTCCTCTTGCCAAGCTCTTAATCACATTCGCTGGC
TTCGCCTTTGGTTATAATGGACATTTTGATTTCAAGGATATTGGAAAAATGTATGAAAATGTACCATACGTTGCG
ATGCGAATGGTTCCGGCAACGCTGGGCGTTGCAACTGTCCCCCTCGCCTACCTCACTCTCCGCGCACTTGACTGT
CGCGCTACCACCGCTCTTTTGGCTTCACTCTTTATCACATTTGAAAACGGCCTCGTCACACAATCAAGACACATC
CTTCTCGATTCTCCCCTTATTTTTTTCACAGCACTTACCGTATTTTTCTGGACCGGCTTTACCAACGAGGACAAG
CATGAACCATTCACTACAAATTGGTGGACATGGCTGGTTTTATCCGGCCTTTCTCTAGGTGCCGTCGTCAGCTGT
AAATGGGTCGGACTATTCACCATTGCAACCATTGGCGTAAGCACCATCTGGCAGTTATGGAATCTACTTGGTGAT
CTTCGTGTTGCTCCGCGGCTGTTCATTCGACATTTCATGGCTCGCGCTATATGCCTTATCGCTCTTCCCATAATA
TTCTACATGCTCATGTTCCAAATCCATTTCCTAATCCTTGAAAACTCGGGCGACGGAGATGGCTTCATGAGCTCC
GAGTTCCAACATACACTCAAAGGCCGCGGAATGGCAGACACGTTTGCAGATGTATCTGTCTATTCCACAGTCACA
ATTCGACATGTTAATACTCAGGGTGGATACCTACATTCTCATCCTCATGCGTATCCTGGTGGCAGTAAACAACAG
CAAATCACTCTTTATCCTCACCGTGACCACAACAATGAATGGCAGATCGCTAACGCTACGGTTATCTCTGATTAT
GACCCTGCATCCTTAGTCCATATCACTCCCAATATGCGTGTCAAGCTCCTGCACACTGCAACCGGAAAACGCCTC
CACTCTCACGACGTTCGACCTCCTGTTTCCGACGTCGATTTTCAGAACGAAGTTTCAGGATACGGTGTGCCCGGA
TACGACGGCGATGCCAATGATGATTGGATCGTCGAAATTGATGACGGTGATTCGCGGGATACGGAGTCGTATAAA
CGTTTACGAACGCTTAGAACGAAATTCCGCTTGAAACACCCTATGACTGGTTGTTACTTATTTTCTCACAAAGTC
AAATTGCCAGATTGGGGTTTTGAACAGCAGGAAGTTACGTGTAATAAGAACGCGGTTCATGATAATTCGCTTTGG
TATATTGAAACTTCAGAGCACGTAAATAATTCCCCGAATGCGCCCAAAGTCAATTACAAACTTCCAGGGTTTTTC
GGCAAATTCTTTGAATTACAAAGAGTTATGTGGACGACCAATGCGGGACTTACAGATCGTCATACTTTTGATTCA
AGACCTGATTCGTGGCCGCTTCTTCGTCGCGGCATCAATTTCTGGGTCAAAGATCATAAACAAATTTACCTAATG
GGAAACCCTATGATATGGTGGTCGAGTACACTCGCCGTGGTACTCTACGCTCTCGTTCGCGGATTTCTTGTCCTT
CGGCAAAAACGCGGCTTTCGCGATTTTGACAATACCAAGGTTGTCAAATACAACACACTCTGTTCATTCCTCTTC
ATCGGTTGGGCCTTGCACTATTTCCCATTCTTCCTGATGGCGCGCCAACTTTTCCTTCACCACTATTTCCCTGCT
CTATATTTCGCTATTCTGTTGTATTGTTCTGTCTTCGATTTGGTAACGTCGACGTTGAGACCTAGAGTGAGATTG
TACGCGGCTGGGATTTTGGTTGTGCTTGCTATTTGGAATTTCCAACATTTTGCACCGCTTGCATACGGGACTGAA
TGGACGAGGGCGCAATGTGAGAATTCAAAATGGATGAAGACTTGGGATTTCTCTTGTGTTGATTTCTACGATGAA
TACTCTCAATATCATGGTTCCCAAGGTACGGGACTCAAAGAGACCCTTGCTGTTACGCCGGAGAATGGCGCTCCA
ATCGTCGTAGACCCTCTAGTCGCTCAAGCCGGCATTCATCAAGACCCTCCAAATCATCACAATCAACAAGAGCAA
GGAAAAGCAGCTGACCTAGAACAGGAACACACGACTATCGATCCTGGAAGACCAGAACCCGGCAGAAACATATTT
GCGGGTGATGGTGAAAATGAAAAAGCGAAGAGTGATAATATTGGAGTACCATCTGATGAAGGTGACGCAAAAAAA
GAGATCAGTTCGGTGAACGTTCCTGCTCCCACAACTGAGATAAAAGTAGAGGGGAAGGAGGGGTTAAAGGGGGAG
AAGGAAGATGATAGAGGAACGCAGTCTACTGAAGGAGAAGGAAAGGTGACGATGGCCATGGCTGCTGATGGTGCT
ACTGAGGGGAAGAAAACTCCCGAAACGGAGAAGGAAGCAGAGGAAGCAGAACAAGGAGCAGCTGATGGAAAGAAA
GATAGACCTCTAGTGGGACCTCATGATGAAGCTGGAGAAGAGGCTGAGAGAGTTGCCGAGGAACTGTTTGGAGAC
GATTCGGATGAGTGA
Transcript >Agabi119p4|069320
ATGGCTGCCAATGTTCGATTCCGGCGACCAGCATCTCCACCTCCAGGCATCGCATATGCTGGTCAGACTAGGTTT
CCACAGCCAAGACAACATTACGACGCCGACGAAAAACGAGCAGCAGCCTCCAAAGGCTTCGGCCCAAGAAGAACT
AAATCCTATCCTTCGGGAGGTCTTAACCTGACAATGGGAGAGCTCAAATTGTTGTTCCTAGTTGTTCTAATTGCT
TGCGGTGTCCGGTTGTTTAGACTTTCGAAACCTCACAGCGTTGTTTTCGACGAGGTACATTTCGGAAAGTTTGCT
TCGAAATACATCAAGAGCCAGTATTTTGTTGATGTCCACCCTCCTCTTGCCAAGCTCTTAATCACATTCGCTGGC
TTCGCCTTTGGTTATAATGGACATTTTGATTTCAAGGATATTGGAAAAATGTATGAAAATGTACCATACGTTGCG
ATGCGAATGGTTCCGGCAACGCTGGGCGTTGCAACTGTCCCCCTCGCCTACCTCACTCTCCGCGCACTTGACTGT
CGCGCTACCACCGCTCTTTTGGCTTCACTCTTTATCACATTTGAAAACGGCCTCGTCACACAATCAAGACACATC
CTTCTCGATTCTCCCCTTATTTTTTTCACAGCACTTACCGTATTTTTCTGGACCGGCTTTACCAACGAGGACAAG
CATGAACCATTCACTACAAATTGGTGGACATGGCTGGTTTTATCCGGCCTTTCTCTAGGTGCCGTCGTCAGCTGT
AAATGGGTCGGACTATTCACCATTGCAACCATTGGCGTAAGCACCATCTGGCAGTTATGGAATCTACTTGGTGAT
CTTCGTGTTGCTCCGCGGCTGTTCATTCGACATTTCATGGCTCGCGCTATATGCCTTATCGCTCTTCCCATAATA
TTCTACATGCTCATGTTCCAAATCCATTTCCTAATCCTTGAAAACTCGGGCGACGGAGATGGCTTCATGAGCTCC
GAGTTCCAACATACACTCAAAGGCCGCGGAATGGCAGACACGTTTGCAGATGTATCTGTCTATTCCACAGTCACA
ATTCGACATGTTAATACTCAGGGTGGATACCTACATTCTCATCCTCATGCGTATCCTGGTGGCAGTAAACAACAG
CAAATCACTCTTTATCCTCACCGTGACCACAACAATGAATGGCAGATCGCTAACGCTACGGTTATCTCTGATTAT
GACCCTGCATCCTTAGTCCATATCACTCCCAATATGCGTGTCAAGCTCCTGCACACTGCAACCGGAAAACGCCTC
CACTCTCACGACGTTCGACCTCCTGTTTCCGACGTCGATTTTCAGAACGAAGTTTCAGGATACGGTGTGCCCGGA
TACGACGGCGATGCCAATGATGATTGGATCGTCGAAATTGATGACGGTGATTCGCGGGATACGGAGTCGTATAAA
CGTTTACGAACGCTTAGAACGAAATTCCGCTTGAAACACCCTATGACTGGTTGTTACTTATTTTCTCACAAAGTC
AAATTGCCAGATTGGGGTTTTGAACAGCAGGAAGTTACGTGTAATAAGAACGCGGTTCATGATAATTCGCTTTGG
TATATTGAAACTTCAGAGCACGTAAATAATTCCCCGAATGCGCCCAAAGTCAATTACAAACTTCCAGGGTTTTTC
GGCAAATTCTTTGAATTACAAAGAGTTATGTGGACGACCAATGCGGGACTTACAGATCGTCATACTTTTGATTCA
AGACCTGATTCGTGGCCGCTTCTTCGTCGCGGCATCAATTTCTGGGTCAAAGATCATAAACAAATTTACCTAATG
GGAAACCCTATGATATGGTGGTCGAGTACACTCGCCGTGGTACTCTACGCTCTCGTTCGCGGATTTCTTGTCCTT
CGGCAAAAACGCGGCTTTCGCGATTTTGACAATACCAAGGTTGTCAAATACAACACACTCTGTTCATTCCTCTTC
ATCGGTTGGGCCTTGCACTATTTCCCATTCTTCCTGATGGCGCGCCAACTTTTCCTTCACCACTATTTCCCTGCT
CTATATTTCGCTATTCTGTTGTATTGTTCTGTCTTCGATTTGGTAACGTCGACGTTGAGACCTAGAGTGAGATTG
TACGCGGCTGGGATTTTGGTTGTGCTTGCTATTTGGAATTTCCAACATTTTGCACCGCTTGCATACGGGACTGAA
TGGACGAGGGCGCAATGTGAGAATTCAAAATGGATGAAGACTTGGGATTTCTCTTGTGTTGATTTCTACGATGAA
TACTCTCAATATCATGGTTCCCAAGGTACGGGACTCAAAGAGACCCTTGCTGTTACGCCGGAGAATGGCGCTCCA
ATCGTCGTAGACCCTCTAGTCGCTCAAGCCGGCATTCATCAAGACCCTCCAAATCATCACAATCAACAAGAGCAA
GGAAAAGCAGCTGACCTAGAACAGGAACACACGACTATCGATCCTGGAAGACCAGAACCCGGCAGAAACATATTT
GCGGGTGATGGTGAAAATGAAAAAGCGAAGAGTGATAATATTGGAGTACCATCTGATGAAGGTGACGCAAAAAAA
GAGATCAGTTCGGTGAACGTTCCTGCTCCCACAACTGAGATAAAAGTAGAGGGGAAGGAGGGGTTAAAGGGGGAG
AAGGAAGATGATAGAGGAACGCAGTCTACTGAAGGAGAAGGAAAGGTGACGATGGCCATGGCTGCTGATGGTGCT
ACTGAGGGGAAGAAAACTCCCGAAACGGAGAAGGAAGCAGAGGAAGCAGAACAAGGAGCAGCTGATGGAAAGAAA
GATAGACCTCTAGTGGGACCTCATGATGAAGCTGGAGAAGAGGCTGAGAGAGTTGCCGAGGAACTGTTTGGAGAC
GATTCGGATGAGTGA
Gene >Agabi119p4|069320
ATGGCTGCCAATGTTCGATTCCGGCGACCAGCATCTCCACCTCCAGGCATCGCATATGCTGGTCAGACTAGGTTT
CCACAGCCAAGACAACATTACGACGCCGACGAAAAACGAGCAGCAGCCTCCAAAGGCTTCGGCCCAAGAAGAACT
AAATCCTATCCTTCGGGAGGTCTTAACCTGACAATGGGAGAGCTCAAATTGTTGTTCCTAGTTGTTCTAATTGCT
TGCGGTGTCCGGTTGTTTAGACTTTCGAAACCTCACAGCGTTGTGTGAGTATTCTTCCATACTCCCAATGTGGAT
ATGAATTTACGTGGTCGTTCCAGTTTCGACGAGGTACATTTCGGAAAGTTTGCTTCGAAATACATCAAGAGCCAG
TATTTTGTTGATGTCCACCCTCCTCTTGCCAAGCTCTTAATCACATTCGCTGGCTTCGCCTTTGGTTATAATGGA
CATTTTGATTTCAAGGATATTGGAAAGTACGTGTGCACGTTTCCTCTAACCTACTTCACCCTCAGTAATTCAATG
CTGCAGAATGTATGAAAATGTACCATACGTTGCGATGCGAATGGTTCCGGCAACGCTGGGCGTTGCAACTGTCCC
CCTCGCCTACCTCACTCTCCGCGCACTTGACTGTCGCGCTACCACCGCTCTTTTGGCTTCACTCTTTATCACATT
TGAAAACGGCCTCGTCACACAATCAAGACACATCCTTCTCGATTCTCCCCTTATTTTTTTCACAGCACTTACCGT
ATTTTTCTGGACCGGCTTTACCAACGAGGACAAGCATGAACCATTCACTACAAATTGGTGGACATGGCTGGTTTT
ATCCGGCCTTTCTCTAGGTGCCGTCGTCAGCTGTAAATGGGTCGGACTATTCACCATTGCAACCATTGGCGTAAG
CACCATCTGGCAGTTATGGAATCTACTTGGTGATCTTCGTGTTGCTCCGCGGCTGTTCATTCGACATTTCATGGC
TCGCGCTATATGCCTTATCGCTCTTCCCATAATATTCTACATGCTCATGTTCCAAATCCATTTCCTAATCCTTGA
AAACTCGGGCGACGGAGATGGCTTCATGAGCTCCGAGTTCCAACATACACTCAAAGGCCGCGGAATGGCAGACAC
GTTTGCAGATGTATCTGTCTATTCCACAGTCACAATTCGACATGTTAATACTCAGGGTGGATACCTACATTCTCA
TCCTCATGCGTATCCTGGTGGCAGTAAACGTATGTTTCTTGATTCCATTAACTTTGTTTCTCACCACATATCTAA
CATTTGACGTCATTCAGAACAGCAAATCACTCTTTATCCTCACCGTGACCACAACAATGAATGGCAGATCGCTAA
CGCTACGGTTATCTCTGATTATGACCCTGCATCCTTAGTCCATATCACTCCCAATATGCGTGTCAAGCTCCTGCA
CACTGCAACCGGAAAACGCCTCCACTCTCACGACGTTCGACCTCCTGTTTCCGACGTCGATTTTCAGAACGAAGT
TTCAGGATACGGTGTGCCCGGATACGACGGCGATGCCAATGATGATTGGATCGTCGAAATTGATGACGGTGATTC
GCGGGATACGGAGTCGTATAAACGTTTACGAACGCTTAGAACGAAATTCCGCTTGAAACACCCTATGACTGGTTG
TTACTTATTTTCTCACAAAGTCAAATTGCCAGATTGGGGTTTTGAACAGCAGGAAGTTACGTGTAATAAGAACGC
GGTTCATGATAATTCGCTTTGGTATATTGAAACTTCAGAGCACGTAAATAGTAGGTCAACTCCCTTTTTTCGTTT
CTTTGTTGCTCATGTGTTTTAGATTCCCCGAATGCGCCCAAAGTCAATTACAAACTTCCAGGGTTTTTCGGCAAA
TTCTTTGAATTACAAAGAGTTATGTGGACGACCAATGCGGGACTTACAGATCGTCATACTTTTGATTCAAGACCT
GATTCGTGGCCGCTTCTTCGTCGCGGCATCGTACGTTGATCTATTCCTGTCATTGACGTTGTTGACTAAGTCTGG
CTATAGAATTTCTGGGTCAAAGATCATAAACAAATTTACCTAATGGGAAACCCTATGATATGGTGGTCGAGTACA
CTCGCCGTGGTACTCTACGCTCTCGTTCGCGGATTTCTTGTCCTTCGGCAAAAACGCGGCTTTCGCGATTTTGAC
AATAGTAAGCATCAACCTCTTCTGACATCGTTTATCCAACATAACTAACGATTCTAAAAGCCAAGGTTGTCAAAT
ACAACACACTCTGTTCATTCCTCTTCATCGGTTGGGCCTTGCACTATTTCCCATTCTTCCTGATGGCGCGCCAAC
TTTTCCTTCACCACTATTTCCCTGCTCTATATTTCGCTATTCTGTTGTATTGTTCTGTCTTCGATTTGGTAACGT
CGACGTTGAGACCTAGAGTGAGATTGTACGCGGCTGGGATTTTGGTTGTGCTTGCTATTTGGAATTTCCAACATT
TTGCACCGCTTGCATACGGGACTGAATGGACGAGGGCGCAATGTGAGAATTCAAAATGGATGAAGACTTGGGATT
TCTCTTGGTGAGTTAGATAATACATTGCTTGGAGTACATTATACTGATGTTGGCCGGTCGGTTAGTGTTGATTTC
TACGATGAAGTACGTGTATTCCTTTTGGTTCGTTGGCTCTTCGATACTGATAGAATATATATAGTACTCTCAATA
TCATGGTTCCCAAGGTACGGGACTCAAAGAGACCCTTGCTGTTACGCCGGAGAATGGCGCTCCAATCGTCGTAGA
CCCTCTAGTCGCTCAAGCCGGCATTCATCAAGACCCTCCAAATCATCACAATCAACAAGAGCAAGGAAAAGCAGC
TGACCTAGAACAGGAACACACGACTATCGATCCTGGAAGACCAGAACCCGGCAGAAACATATTTGCGGGTGATGG
TGAAAATGAAAAAGCGAAGAGTGATAATATTGGAGTACCATCTGATGAAGGTGACGCAAAAAAAGAGATCAGTTC
GGTGAACGTTCCTGCTCCCACAACTGAGATAAAAGTAGAGGGGAAGGAGGGGTTAAAGGGGGAGAAGGAAGATGA
TAGAGGAACGCAGTCTACTGAAGGAGAAGGAAAGGTGACGATGGCCATGGCTGCTGATGGTGCTACTGAGGGGAA
GAAAACTCCCGAAACGGAGAAGGAAGCAGAGGAAGCAGAACAAGGAGCAGCTGATGGAAAGAAAGATAGACCTCT
AGTGGGACCTCATGATGAAGCTGGAGAAGAGGCTGAGAGAGTTGCCGAGGAACTGTTTGGAGACGATTCGGATGA
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail