Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|068640
Gene name
Locationscaffold_04:992176..994581
Strand+
Gene length (bp)2405
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00994 MoCF_biosynth Probable molybdopterin binding domain 3.9E-26 7 164
PF00994 MoCF_biosynth Probable molybdopterin binding domain 8.2E-28 421 570
PF03453 MoeA_N MoeA N-terminal region (domain I and II) 2.5E-36 238 408
PF03454 MoeA_C MoeA C-terminal region (domain IV) 1.6E-16 586 658

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39205|CIN_DROME Molybdenum cofactor synthesis protein cinnamon OS=Drosophila melanogaster GN=cin PE=1 SV=3 1 638 1.0E-90
sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens GN=GPHN PE=1 SV=1 225 662 2.0E-85
sp|Q03555|GEPH_RAT Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 225 662 2.0E-85
sp|Q8BUV3|GEPH_MOUSE Gephyrin OS=Mus musculus GN=Gphn PE=1 SV=2 225 662 2.0E-85
sp|Q9PW38|GEPH_CHICK Gephyrin OS=Gallus gallus GN=GPHN PE=1 SV=1 225 662 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39205|CIN_DROME Molybdenum cofactor synthesis protein cinnamon OS=Drosophila melanogaster GN=cin PE=1 SV=3 1 638 1.0E-90
sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens GN=GPHN PE=1 SV=1 225 662 2.0E-85
sp|Q03555|GEPH_RAT Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 225 662 2.0E-85
sp|Q8BUV3|GEPH_MOUSE Gephyrin OS=Mus musculus GN=Gphn PE=1 SV=2 225 662 2.0E-85
sp|Q9PW38|GEPH_CHICK Gephyrin OS=Gallus gallus GN=GPHN PE=1 SV=1 225 662 2.0E-81
sp|Q39054|CNX1_ARATH Molybdopterin biosynthesis protein CNX1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=2 235 664 3.0E-69
sp|P45210|MOEA_HAEIN Molybdopterin molybdenumtransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeA PE=3 SV=1 252 637 3.0E-49
sp|Q56066|MOEA_SALTY Molybdopterin molybdenumtransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeA PE=3 SV=2 236 637 2.0E-47
sp|P12281|MOEA_ECOLI Molybdopterin molybdenumtransferase OS=Escherichia coli (strain K12) GN=moeA PE=1 SV=1 236 637 1.0E-43
sp|O31703|MOEA_BACSU Molybdopterin molybdenumtransferase OS=Bacillus subtilis (strain 168) GN=moeA PE=3 SV=1 240 661 2.0E-41
sp|Q5HDT4|MOEA_STAAC Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain COL) GN=moeA PE=3 SV=1 240 658 2.0E-41
sp|P99139|MOEA_STAAN Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain N315) GN=moeA PE=1 SV=1 240 658 3.0E-41
sp|P65407|MOEA_STAAM Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moeA PE=3 SV=1 240 658 3.0E-41
sp|Q8NVA1|MOEA_STAAW Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MW2) GN=moeA PE=3 SV=1 240 658 7.0E-41
sp|Q6G749|MOEA_STAAS Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MSSA476) GN=moeA PE=3 SV=1 240 658 7.0E-41
sp|Q6GEG1|MOEA_STAAR Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MRSA252) GN=moeA PE=3 SV=1 240 658 1.0E-40
sp|Q8CNE1|MOEA_STAES Molybdopterin molybdenumtransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moeA PE=3 SV=1 237 658 1.0E-38
sp|Q5HLX6|MOEA_STAEQ Molybdopterin molybdenumtransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moeA PE=3 SV=1 237 658 1.0E-38
sp|Q58296|Y886_METJA Putative molybdopterin biosynthesis protein MJ0886 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0886 PE=3 SV=1 236 663 4.0E-36
sp|Q56207|MOEA_SYNE7 Molybdopterin molybdenumtransferase OS=Synechococcus elongatus (strain PCC 7942) GN=moeA PE=3 SV=1 236 638 9.0E-35
sp|Q44243|MOEA_NOSS1 Molybdopterin molybdenumtransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moeA PE=3 SV=1 233 638 8.0E-33
sp|Q58080|Y666_METJA Putative molybdopterin biosynthesis protein MJ0666 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0666 PE=3 SV=1 266 659 5.0E-29
sp|Q8BUV3|GEPH_MOUSE Gephyrin OS=Mus musculus GN=Gphn PE=1 SV=2 4 176 2.0E-28
sp|Q9PW38|GEPH_CHICK Gephyrin OS=Gallus gallus GN=GPHN PE=1 SV=1 4 176 2.0E-28
sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens GN=GPHN PE=1 SV=1 4 176 2.0E-28
sp|Q39054|CNX1_ARATH Molybdopterin biosynthesis protein CNX1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=2 3 185 3.0E-27
sp|Q03555|GEPH_RAT Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 4 176 2.0E-25
sp|Q54KM0|GEPH_DICDI Gephyrin OS=Dictyostelium discoideum GN=gphn PE=3 SV=1 6 175 3.0E-25
sp|P9WJQ4|MOEA2_MYCTO Molybdopterin molybdenumtransferase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaE2 PE=3 SV=1 238 638 5.0E-21
sp|P9WJQ5|MOEA2_MYCTU Molybdopterin molybdenumtransferase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaE2 PE=1 SV=1 238 638 5.0E-21
sp|Q8NV99|MOAB_STAAW Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain MW2) GN=moaB PE=3 SV=1 5 172 1.0E-20
sp|Q6G747|MOAB_STAAS Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain MSSA476) GN=moaB PE=3 SV=1 5 172 1.0E-20
sp|Q5HDT2|MOAB_STAAC Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain COL) GN=moaB PE=3 SV=1 5 172 1.0E-20
sp|P99137|MOAB_STAAN Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain N315) GN=moaB PE=1 SV=1 5 172 2.0E-20
sp|P65406|MOAB_STAAM Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moaB PE=3 SV=1 5 172 2.0E-20
sp|P56421|MOG_HELPY Molybdopterin adenylyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=mog PE=3 SV=1 1 177 5.0E-20
sp|Q9ZL45|MOG_HELPJ Molybdopterin adenylyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=mog PE=1 SV=1 1 177 6.0E-20
sp|Q6GEF9|MOAB_STAAR Molybdenum cofactor biosynthesis protein B OS=Staphylococcus aureus (strain MRSA252) GN=moaB PE=3 SV=1 5 172 8.0E-20
sp|P9WJQ6|MOEA1_MYCTO Molybdopterin molybdenumtransferase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeA1 PE=3 SV=1 268 661 8.0E-20
sp|P9WJQ7|MOEA1_MYCTU Molybdopterin molybdenumtransferase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeA1 PE=1 SV=1 268 661 8.0E-20
sp|Q55368|MOEA_SYNY3 Molybdopterin molybdenumtransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=moeA PE=3 SV=1 236 638 1.0E-19
sp|Q8CMK6|MOAB_STAES Molybdenum cofactor biosynthesis protein B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaB PE=3 SV=1 6 174 8.0E-19
sp|Q5HLX4|MOAB_STAEQ Molybdenum cofactor biosynthesis protein B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaB PE=3 SV=1 6 174 8.0E-19
sp|P44645|MOG_HAEIN Molybdopterin adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mog PE=1 SV=1 4 166 2.0E-16
sp|P0AF05|MOG_SHIFL Molybdopterin adenylyltransferase OS=Shigella flexneri GN=mog PE=3 SV=1 1 159 5.0E-16
sp|P0AF04|MOG_ECO57 Molybdopterin adenylyltransferase OS=Escherichia coli O157:H7 GN=mog PE=3 SV=1 1 159 5.0E-16
sp|P0AF03|MOG_ECOLI Molybdopterin adenylyltransferase OS=Escherichia coli (strain K12) GN=mog PE=1 SV=1 1 159 5.0E-16
sp|Q9ZIN3|MOAB_STACT Molybdenum cofactor biosynthesis protein B OS=Staphylococcus carnosus (strain TM300) GN=moaB PE=3 SV=1 3 172 1.0E-14
sp|Q8U3T3|MOAB_PYRFU Molybdopterin adenylyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=moaB PE=1 SV=1 4 173 5.0E-13
sp|Q9K8I4|MOAB_BACHD Molybdenum cofactor biosynthesis protein B OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=moaB PE=3 SV=1 5 156 1.0E-12
sp|Q816R0|MOAB_BACCR Molybdenum cofactor biosynthesis protein B OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=moaB PE=1 SV=1 3 176 2.0E-12
sp|P59014|MOACB_CHLTE Molybdenum cofactor biosynthesis bifunctional protein OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=moaCB PE=3 SV=1 5 177 3.0E-12
sp|Q81KI3|MOAB_BACAN Molybdenum cofactor biosynthesis protein B OS=Bacillus anthracis GN=moaB PE=3 SV=1 3 176 2.0E-11
sp|Q57631|MOAB_METJA Probable molybdopterin adenylyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=moaB PE=3 SV=1 1 178 2.0E-10
sp|O34457|MOAB_BACSU Molybdenum cofactor biosynthesis protein B OS=Bacillus subtilis (strain 168) GN=moaB PE=3 SV=1 5 176 3.0E-10
sp|Q56208|MOACB_SYNE7 Molybdenum cofactor biosynthesis bifunctional protein OS=Synechococcus elongatus (strain PCC 7942) GN=moaCB PE=3 SV=1 8 177 9.0E-09
sp|P0AEZ9|MOAB_ECOLI Molybdenum cofactor biosynthesis protein B OS=Escherichia coli (strain K12) GN=moaB PE=1 SV=2 5 156 1.0E-08
sp|P0AF00|MOAB_ECO57 Molybdenum cofactor biosynthesis protein B OS=Escherichia coli O157:H7 GN=moaB PE=3 SV=2 5 156 1.0E-08
sp|Q8ZYA5|Y875_PYRAE Protein PAE0875 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE0875 PE=3 SV=1 417 505 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0032324 molybdopterin cofactor biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0051189 prosthetic group metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|068640
MSDFRVAVLTVSDTAFKDASADKSGPAIIDILHAHKGFKLASDTTGSTDPFYKIVPDDLDHIRTAVKTWIDQDGG
GGGGGGGVDWVITTGGTGFGVRDVTPEAIKVLLDREAPGLVHLLLSASLQHTPLGALSRPVAGTCKNTLIITLPG
SPKAVKETLAALFNQDLINHALELVRGGTGENRHILLSGQQSQSFQAVRHHHHHHHGHQIPKPRSVLSHDPSAHV
SARHRQSPYELVSFEDAIRLIKDNIQPLETQTLPVDAGLRNHVLAEDIFAPNNTPPRATTSVDGYALRSTDPPAV
YQVVSSRNHPIDQPLPSGIIYRINTGGPLPVGTDTVIMVEDTKLVSSFEATDNELEGEEKEVETLVTVPRGENVR
APGSDVRKGDLVLQKGERILSNGGEIGTLAFVGRRETLVYKKPIVAILSTGNEIVDLQTHTTTQEAEWGGIFDTN
RPSLRAALEGLGYSVIDLGIVPDKVDDHVAAIQKGIDSADILITTGGTSMGPTDLFKPVIERHFNGTIHFGRVTI
KPGKPTTFATIPVAGGVAKPLFALPGNPASALVTFHIFVLPALRKLAGWPSNMLELPRVSAELQSPMSLDPRTEF
HRAVLRIEKGGLKAYSTGGQRSSRVASLAGANGFVVVPPLGSNAVRQLEVGANVDVMVIGEIQSVL*
Coding >Agabi119p4|068640
ATGTCAGACTTTCGCGTCGCAGTCCTTACAGTTAGCGACACCGCATTCAAAGATGCATCAGCAGATAAGTCGGGC
CCGGCGATAATAGACATTCTCCATGCACACAAAGGTTTCAAACTGGCTTCTGACACTACGGGTTCGACAGATCCG
TTCTACAAGATCGTTCCTGATGACTTGGATCACATACGAACTGCGGTCAAAACGTGGATTGATCAAGATGGTGGT
GGTGGTGGTGGTGGTGGTGGTGTGGATTGGGTTATCACCACTGGTGGAACTGGATTCGGCGTACGAGATGTAACG
CCCGAAGCGATCAAAGTTTTGTTAGACAGAGAGGCTCCCGGTCTTGTTCACCTTTTACTATCTGCATCGCTTCAA
CACACTCCACTGGGCGCTCTATCTCGCCCAGTTGCCGGAACATGCAAAAATACGCTTATAATCACTCTGCCTGGT
AGTCCAAAGGCGGTCAAGGAAACTCTTGCAGCATTATTCAATCAAGATCTCATCAACCATGCCTTAGAACTTGTC
AGAGGAGGTACAGGGGAAAATCGTCATATCCTTCTATCAGGTCAACAATCCCAGTCGTTTCAGGCCGTTCGCCAC
CATCACCACCACCATCACGGACACCAGATCCCCAAACCACGCAGCGTTCTATCCCACGATCCATCAGCTCATGTA
TCTGCGAGGCATCGTCAATCTCCCTACGAGCTTGTTTCATTCGAAGACGCGATCCGGCTCATCAAGGATAACATC
CAACCACTCGAAACCCAAACCCTTCCCGTTGATGCCGGACTTCGCAATCATGTACTTGCGGAGGACATTTTCGCT
CCTAATAATACGCCCCCACGGGCAACTACAAGCGTAGATGGCTATGCATTGCGCTCAACGGACCCCCCCGCTGTC
TACCAAGTCGTTAGCTCGAGGAACCATCCTATTGACCAACCACTTCCATCCGGTATCATATATCGCATCAACACT
GGTGGTCCCTTGCCCGTCGGCACGGATACCGTCATCATGGTAGAAGATACGAAACTGGTCTCTTCATTTGAGGCG
ACTGATAATGAATTGGAGGGTGAAGAAAAAGAAGTCGAGACATTGGTTACGGTTCCTCGAGGAGAAAATGTCCGA
GCTCCTGGTTCCGATGTGCGCAAGGGTGACTTAGTCCTGCAAAAAGGAGAGCGCATCTTGAGTAATGGTGGGGAG
ATTGGCACACTCGCGTTCGTCGGAAGAAGGGAAACATTGGTATACAAAAAACCAATTGTGGCCATCTTGAGTACT
GGAAATGAAATCGTAGACTTGCAAACGCATACAACGACGCAAGAGGCGGAGTGGGGTGGTATCTTCGACACGAAT
AGACCGTCGCTTCGTGCCGCTTTAGAGGGTCTAGGATATTCGGTGATAGATTTGGGCATTGTACCAGACAAAGTC
GACGACCATGTGGCGGCAATACAGAAGGGAATTGACAGTGCGGATATCTTGATTACAACTGGTGGAACTTCCATG
GGACCGACCGATTTGTTCAAACCCGTCATTGAGAGGCACTTTAACGGGACAATTCATTTCGGGCGAGTGACCATA
AAGCCGGGTAAGCCGACGACATTCGCAACTATCCCAGTGGCTGGAGGAGTGGCAAAACCCTTGTTTGCATTGCCG
GGAAACCCGGCTTCAGCTCTCGTAACATTCCACATCTTCGTGTTACCAGCTCTACGAAAGCTCGCAGGCTGGCCT
TCGAATATGCTGGAGCTGCCAAGGGTCAGCGCTGAGCTCCAATCGCCAATGAGCTTAGATCCCCGTACAGAATTT
CATCGTGCTGTACTTCGAATCGAGAAGGGTGGCCTGAAAGCATATAGTACTGGGGGGCAACGGTCGAGTCGTGTG
GCAAGCTTAGCCGGGGCTAATGGATTCGTTGTAGTGCCACCACTGGGAAGTAATGCAGTAAGACAACTTGAGGTC
GGGGCGAATGTGGATGTGATGGTAATTGGGGAGATACAGAGTGTTCTGTAA
Transcript >Agabi119p4|068640
ATGTCAGACTTTCGCGTCGCAGTCCTTACAGTTAGCGACACCGCATTCAAAGATGCATCAGCAGATAAGTCGGGC
CCGGCGATAATAGACATTCTCCATGCACACAAAGGTTTCAAACTGGCTTCTGACACTACGGGTTCGACAGATCCG
TTCTACAAGATCGTTCCTGATGACTTGGATCACATACGAACTGCGGTCAAAACGTGGATTGATCAAGATGGTGGT
GGTGGTGGTGGTGGTGGTGGTGTGGATTGGGTTATCACCACTGGTGGAACTGGATTCGGCGTACGAGATGTAACG
CCCGAAGCGATCAAAGTTTTGTTAGACAGAGAGGCTCCCGGTCTTGTTCACCTTTTACTATCTGCATCGCTTCAA
CACACTCCACTGGGCGCTCTATCTCGCCCAGTTGCCGGAACATGCAAAAATACGCTTATAATCACTCTGCCTGGT
AGTCCAAAGGCGGTCAAGGAAACTCTTGCAGCATTATTCAATCAAGATCTCATCAACCATGCCTTAGAACTTGTC
AGAGGAGGTACAGGGGAAAATCGTCATATCCTTCTATCAGGTCAACAATCCCAGTCGTTTCAGGCCGTTCGCCAC
CATCACCACCACCATCACGGACACCAGATCCCCAAACCACGCAGCGTTCTATCCCACGATCCATCAGCTCATGTA
TCTGCGAGGCATCGTCAATCTCCCTACGAGCTTGTTTCATTCGAAGACGCGATCCGGCTCATCAAGGATAACATC
CAACCACTCGAAACCCAAACCCTTCCCGTTGATGCCGGACTTCGCAATCATGTACTTGCGGAGGACATTTTCGCT
CCTAATAATACGCCCCCACGGGCAACTACAAGCGTAGATGGCTATGCATTGCGCTCAACGGACCCCCCCGCTGTC
TACCAAGTCGTTAGCTCGAGGAACCATCCTATTGACCAACCACTTCCATCCGGTATCATATATCGCATCAACACT
GGTGGTCCCTTGCCCGTCGGCACGGATACCGTCATCATGGTAGAAGATACGAAACTGGTCTCTTCATTTGAGGCG
ACTGATAATGAATTGGAGGGTGAAGAAAAAGAAGTCGAGACATTGGTTACGGTTCCTCGAGGAGAAAATGTCCGA
GCTCCTGGTTCCGATGTGCGCAAGGGTGACTTAGTCCTGCAAAAAGGAGAGCGCATCTTGAGTAATGGTGGGGAG
ATTGGCACACTCGCGTTCGTCGGAAGAAGGGAAACATTGGTATACAAAAAACCAATTGTGGCCATCTTGAGTACT
GGAAATGAAATCGTAGACTTGCAAACGCATACAACGACGCAAGAGGCGGAGTGGGGTGGTATCTTCGACACGAAT
AGACCGTCGCTTCGTGCCGCTTTAGAGGGTCTAGGATATTCGGTGATAGATTTGGGCATTGTACCAGACAAAGTC
GACGACCATGTGGCGGCAATACAGAAGGGAATTGACAGTGCGGATATCTTGATTACAACTGGTGGAACTTCCATG
GGACCGACCGATTTGTTCAAACCCGTCATTGAGAGGCACTTTAACGGGACAATTCATTTCGGGCGAGTGACCATA
AAGCCGGGTAAGCCGACGACATTCGCAACTATCCCAGTGGCTGGAGGAGTGGCAAAACCCTTGTTTGCATTGCCG
GGAAACCCGGCTTCAGCTCTCGTAACATTCCACATCTTCGTGTTACCAGCTCTACGAAAGCTCGCAGGCTGGCCT
TCGAATATGCTGGAGCTGCCAAGGGTCAGCGCTGAGCTCCAATCGCCAATGAGCTTAGATCCCCGTACAGAATTT
CATCGTGCTGTACTTCGAATCGAGAAGGGTGGCCTGAAAGCATATAGTACTGGGGGGCAACGGTCGAGTCGTGTG
GCAAGCTTAGCCGGGGCTAATGGATTCGTTGTAGTGCCACCACTGGGAAGTAATGCAGTAAGACAACTTGAGGTC
GGGGCGAATGTGGATGTGATGGTAATTGGGGAGATACAGAGTGTTCTGTAA
Gene >Agabi119p4|068640
ATGTCAGACTTTCGCGTCGCAGTCCTTACAGGTCTGTAAGACCCATCATCACTCATAAGATCCCATCAAAAATAA
CTAAACCGTCTCGGATCCGAAATCGTATTAAATAGTTAGCGACACCGCATTCAAAGATGCATCAGCAGATAAGTC
GGGCCCGGCGATAATAGACATTCTCCATGCACACAAAGGTTTCAAACTGGCTTCTGACACTACGGGTTCGACAGA
TCCGTTCTACAAGATCGTTCCTGATGACTTGGATCACATACGAACTGCGGTCAAAACGTGGATTGATCAAGATGG
TGGTGGTGGTGGTGGTGGTGGTGGTGTGGATTGGGTTATCACCACTGGTGGAACTGGATTCGGCGTACGAGATGT
AACGCCCGAAGTAAGTAGTAAAAATGGTCCTAGGCCGAATAGTGTTCAGCATGTTCAGATCTCAGTTCTAGGCGA
TCAAAGTTTTGTTAGACAGAGAGGCTCCCGGTCTTGTTCACCTTTTACTATCTGCATCGCTTCAACACACTCCAC
TGGGCGCTCTATCTCGCCCAGTTGCCGGAACATGCAAAAATACGCTTATAATCACTCTGCCTGGTAGTCCAAAGG
CGGTCAAGGAAACTCTTGCAGCATTATTCAATCAAGATCTCATCAACCATGCCTTAGAACTTGTCAGAGGAGGTA
CAGGGGAAAATCGTCATATCCTTCTATCAGGTCAACAATCCCAGTCGTTTCAGGCCGTTCGCCACCATCACCACC
ACCATCACGGACACCAGATCCCCAAACCACGCAGCGTTCTATCCCACGATCCATCAGCTCATGGTGAGTTCCCCG
TCATCTGATAACCGACCGACACTCCAACTGATGGCCCAAAGTATCTGCGAGGCATCGTCAATCTCCCTACGAGCT
TGTTTCATTCGAAGACGCGATCCGGCTCATCAAGGATAACATCCAACCACTCGAAACCCAAACCCTTCCCGTGCG
CACTTTGAGCCTGGTGCATCTACTCGATGCTAATCCATGATTTGTCCACTTTAGGTTGATGCCGGACTTCGCAAT
CATGTACTTGCGGAGGACATTTTCGCTCCTAATAATACGCCCCCACGGGCAACTACAAGCGTAGATGGCTATGCA
TTGCGCTGTGAGCCCCTTCATTCTTTTTCAGGGTAGTAACGATTAACAGAAACGATCAGCAACGGACCCCCCCGC
TGTCTACCAAGTCGTTAGCTCGAGGAACCATCCTATTGACCAACCACTTCCATCCGGTATCATATATCGCATCAA
CACTGGTGGTCCCTTGCCCGTCGGCACGGATACCGTCATCATGGTAGAAGATACGAAACTGGTCTCTTCATTTGA
GGCGACTGATAATGAATTGGAGGGTGAAGAAAAAGAAGTCGAGACATTGGTTACGGTTCCTCGAGGAGAAAATGT
CCGAGCTCCTGGTTCCGATGTGCGCAAGGGTGACTTAGTCCTGCAAAAAGGAGAGCGCATCTTGAGTAATGGTGG
GGAGATTGGCACACTCGCGTTCGTCGGAAGAAGGGAAACATTGGTATACAAAAAACCAATTGTGGCCATCTTGAG
TACTGGAAATGAAATCGTAGACTTGCAAACGCATACAACGACGCAAGAGGCGGAGTGGGGTGGTATCTTCGACAC
GAATAGACCGTCGCTTCGTGCCGCTTTAGAGGGTCTAGGATATTCGGTGATAGATTTGGGCATTGTACCAGACAA
GTAAGCTGGGGATATTCGTATATCTCGGAAACTAATATTGTGGCAATAGAGTCGACGACCATGTGGCGGCAATAC
AGAAGGGAATTGACAGTGCGGATATCTTGATTACAACTGGTGGAACTTCCATGGGACCGACCGATTTGTTCAAAC
CCGTCATTGAGAGGCACTTTAACGGGACAATTCATTTCGGGCGAGTGACCATAAAGCCGGGTAAGCCGACGACAT
TCGCAACTATCCCAGTGGCTGGAGGAGTGGCAAAACCCTTGTTTGCATTGCCGGGAAACCCGGCTTCAGCTCTCG
TAACATTCCACATCTTCGTGTTACCAGCTCTACGAAAGCTCGCAGGCTGGCCTTCGAATATGCTGGAGCTGCCAA
GGGTCAGCGCTGAGGTGAGATGTCGTGTCAGTTGTTCATGTTATGAGAGCCTAAAGCAATTCTAGCTCCAATCGC
CAATGAGCTTAGATCCCCGTACAGAATTTCATCGTGCTGTACTTCGAATCGAGAAGGGTGGCCTGAAAGCATATA
GTACTGGGGGGCAACGGTCGAGTCGTGTGGCAAGCTTAGCCGGGGCTAATGGATTCGTTGTAGTGCCACCACTGG
GAAGTAATGCAGTAAGACAACTTGAGGTCGGGGCGAATGTGGATGTGATGGTAATTGGGGAGATACAGAGTGTTC
TGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail