Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|068490
Gene name
Locationscaffold_04:955202..958820
Strand+
Gene length (bp)3618
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.0E-27 253 700

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94543|YCD3_SCHPO Uncharacterized membrane protein C1322.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.03 PE=3 SV=1 493 787 2.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 377 399 22
3 494 516 22
4 528 550 22
5 580 602 22
6 609 631 22
7 635 657 22
8 670 692 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|068490
MRSRPGGLPPSLLSLLLALLPFAHAGPATLPFKDCFDDTTSQAQKLNVSTIYAQVLQNNDLGEYLDLTVLGQSPQ
QIFGMTNTSGSLSTLFTTTSVLTLNAWTNSSYLCDTLRPPSPLPQVNQQTNNYCPLAAGPFALSANIPWGSNRAL
TTLVTRLRAVDPFGHELVCIDVSTTPLRPSTKDGPYGDARVILWASVALAAAYWLVVGVARVVSAWGRGVSRSAH
GVWGKLQSGGFILASAISGERLATSPALMRYCTPSLRDVIFHTQWCATLAMIAVQWPPFIYPLLTQTAWSTLTFN
LTLISPSTPHRWDPLSTLLFSPPDDFSEQLADSSSPLFIDTAAPNFLFTLPQNASNGIQSFAYAVGIRPEELFPN
CLILFLGIVAATIVLSTLLWALDYFMVAVVFKYTSRTGYSTNLSRSRSPAFNASISTRSALNKDAFESTTSPMSG
DESKSLTGHSTGGNSIFGVGTRAVGSHRSWWRLRTDIGSFHGSVLHGNLVRILVLFHLPITTFSAFQMVQHGSGV
SRTSVALAALSFAIFSVLIPLHLVLKVTFTTTNKLYDETRTLLSLGPLYNHYRHGSQMFATLLFATNLVFGVTIG
AGQKSGMAQAIIILVVEVMSALGTSIWLPWGSGASMGLISFLFCVARIVIAVLLVILTPTISIGPGPGGWVAYGI
LIILALVYLALLVMLFFKLVEAVFRIVGGLGFDRSRHVSDSGLLGVLGLLGWCGFRSHSKRRRKKSRKAPRHKSS
QGLPEMSPYATPDPLLPSVPPFLHSDSRKASTHSGPPPSVLRPEHALPKPYREDDDDEGYIMGAWQPYSQKAGYA
PVAEPAPTSPPQPKSGFSRIGGGRSHIDTPYAIMDGSGSAFAARNGSIQAIASSSMHALGNGSTHTFPSVKQQTQ
DGSFYRGYGGTAASGSVTALYEDDDPQPSLSSLTNVGRQAEYGQLPPGAMQPAHVRTKSQTAIIEDASKVYGLAA
TLTVNPSGSSNSNSEGGVGAVRPPRFSVSVDDDDDDDSSTIEEQPKKKPWYRIGRRRPDGSDGPSSSSSTAAPAV
DSELGGMSMSGADGSSNDASGSLSAQPTRSFVVIRRTQPQSMNQLNQSRNASRLQNTTYPPS*
Coding >Agabi119p4|068490
ATGCGCTCGCGTCCAGGCGGTCTACCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCCCAAAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGAGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACCAACACTAGCGGCAGCCTCTCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAAC
GCGTGGACGAACAGCTCATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACC
AATAACTACTGTCCTCTCGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGCTG
ACGACACTGGTTACAAGACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACC
CCACTTCGGCCATCAACGAAAGACGGACCTTATGGTGATGCTCGGGTAATTTTGTGGGCTAGCGTGGCATTGGCT
GCAGCTTATTGGCTTGTTGTGGGTGTGGCTAGAGTGGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACAT
GGTGTTTGGGGGAAGCTGCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCT
CCCGCATTGATGCGATACTGCACGCCGTCGCTGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCT
ATGATTGCTGTTCAGTGGCCTCCGTTCATTTACCCTCTTCTGACCCAAACTGCTTGGTCCACGCTTACTTTTAAT
CTCACTCTCATCTCACCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTCTCGCCGCCTGACGAT
TTTTCTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTC
CCACAAAATGCGTCTAATGGCATTCAATCTTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAAT
TGCCTTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTT
ATGGTCGCAGTCGTGTTCAAGTACACCTCCCGTACGGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCC
TTCAATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGA
GATGAAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGA
TCACACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAATTTGGTC
CGTATTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTC
AGTCGCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCATATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTG
AAAGTGACATTTACGACAACCAACAAACTATATGATGAAACACGGACATTGTTATCTCTTGGGCCTTTGTATAAC
CATTACAGGCATGGTTCGCAGATGTTTGCAACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGC
GCTGGGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGT
ATTTGGCTGCCATGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATT
GCGGTTCTTTTGGTCATCCTGACACCGACGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATA
CTCATCATTCTTGCACTCGTTTATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGT
ATTGTTGGTGGTTTGGGCTTTGATCGTAGTCGACATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTG
GGCTGGTGCGGATTCCGATCCCACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCT
CAGGGGCTACCCGAAATGAGCCCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCT
GATAGCAGGAAAGCTTCGACACATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCA
TATCGAGAGGATGATGATGATGAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATGCT
CCAGTTGCGGAGCCTGCTCCTACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCA
CATATCGATACTCCGTATGCTATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCC
ATTGCTAGTTCATCTATGCATGCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAA
GATGGATCATTTTATCGGGGATATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGAT
CCACAACCTTCGTTATCATCTCTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATG
CAACCTGCTCACGTGCGTACAAAGTCGCAGACCGCCATAATTGAAGATGCGAGTAAAGTGTATGGCCTCGCCGCT
ACTCTGACGGTTAACCCCAGCGGGTCTTCTAATAGTAATTCTGAGGGCGGCGTAGGCGCTGTCCGGCCACCGCGG
TTTTCTGTTAGTGTGGACGATGACGACGACGACGATAGTAGTACTATTGAAGAACAACCGAAGAAGAAGCCGTGG
TACCGTATTGGCCGACGGCGGCCCGATGGTAGTGATGGTCCTTCATCTTCATCGTCGACTGCAGCGCCCGCTGTG
GACTCCGAATTGGGTGGCATGTCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCA
CAGCCAACAAGGTCGTTTGTTGTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAAT
GCGAGCCGGCTTCAGAATACAACTTACCCTCCATCATAG
Transcript >Agabi119p4|068490
ATGCGCTCGCGTCCAGGCGGTCTACCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCCCAAAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGAGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACCAACACTAGCGGCAGCCTCTCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAAC
GCGTGGACGAACAGCTCATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACC
AATAACTACTGTCCTCTCGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGCTG
ACGACACTGGTTACAAGACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACC
CCACTTCGGCCATCAACGAAAGACGGACCTTATGGTGATGCTCGGGTAATTTTGTGGGCTAGCGTGGCATTGGCT
GCAGCTTATTGGCTTGTTGTGGGTGTGGCTAGAGTGGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACAT
GGTGTTTGGGGGAAGCTGCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCT
CCCGCATTGATGCGATACTGCACGCCGTCGCTGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCT
ATGATTGCTGTTCAGTGGCCTCCGTTCATTTACCCTCTTCTGACCCAAACTGCTTGGTCCACGCTTACTTTTAAT
CTCACTCTCATCTCACCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTCTCGCCGCCTGACGAT
TTTTCTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTC
CCACAAAATGCGTCTAATGGCATTCAATCTTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAAT
TGCCTTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTT
ATGGTCGCAGTCGTGTTCAAGTACACCTCCCGTACGGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCC
TTCAATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGA
GATGAAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGA
TCACACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAATTTGGTC
CGTATTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTC
AGTCGCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCATATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTG
AAAGTGACATTTACGACAACCAACAAACTATATGATGAAACACGGACATTGTTATCTCTTGGGCCTTTGTATAAC
CATTACAGGCATGGTTCGCAGATGTTTGCAACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGC
GCTGGGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGT
ATTTGGCTGCCATGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATT
GCGGTTCTTTTGGTCATCCTGACACCGACGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATA
CTCATCATTCTTGCACTCGTTTATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGT
ATTGTTGGTGGTTTGGGCTTTGATCGTAGTCGACATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTG
GGCTGGTGCGGATTCCGATCCCACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCT
CAGGGGCTACCCGAAATGAGCCCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCT
GATAGCAGGAAAGCTTCGACACATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCA
TATCGAGAGGATGATGATGATGAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATGCT
CCAGTTGCGGAGCCTGCTCCTACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCA
CATATCGATACTCCGTATGCTATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCC
ATTGCTAGTTCATCTATGCATGCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAA
GATGGATCATTTTATCGGGGATATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGAT
CCACAACCTTCGTTATCATCTCTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATG
CAACCTGCTCACGTGCGTACAAAGTCGCAGACCGCCATAATTGAAGATGCGAGTAAAGTGTATGGCCTCGCCGCT
ACTCTGACGGTTAACCCCAGCGGGTCTTCTAATAGTAATTCTGAGGGCGGCGTAGGCGCTGTCCGGCCACCGCGG
TTTTCTGTTAGTGTGGACGATGACGACGACGACGATAGTAGTACTATTGAAGAACAACCGAAGAAGAAGCCGTGG
TACCGTATTGGCCGACGGCGGCCCGATGGTAGTGATGGTCCTTCATCTTCATCGTCGACTGCAGCGCCCGCTGTG
GACTCCGAATTGGGTGGCATGTCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCA
CAGCCAACAAGGTCGTTTGTTGTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAAT
GCGAGCCGGCTTCAGAATACAACTTACCCTCCATCATAG
Gene >Agabi119p4|068490
ATGCGCTCGCGTCCAGGCGGTCTACCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCCCAAAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGAGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACCAACACTAGCGGCAGCCTCTGTCAGTTTATCTTCTCTGCTGCTGGCTAGGTCAGCGAG
CTAACACTTTCTTCCTATAGCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAACGCGTGGACGAACAGCTC
ATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACCAATAACTACTGTCCTCT
CGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGCTGACGACACTGGTTACAAG
ACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACCCCACTTCGGCCATCAAC
GAAAGACGGACCTTATGGTGATGCTCGGGTAATTTTGTGGGCTAGCGTGGCATTGGCTGCAGCTTATTGGCTTGT
TGTGGGTGTGGCTAGAGTGGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACATGGTGTTTGGGGGAAGCT
GCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCTCCCGCATTGATGCGATA
CTGTGGGTCCCTTCCTCCTTTCACTGTTGGTACAGTTTGCCTGATATTCGCCTCGGCGTATAGGCACGCCGTCGC
TGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCTATGATTGCTGTTCAGTGGCCTCCGTTCATTT
GTAAGTTTCAGGGGCGTCTAACTGCTTCTTTGATTGATCCGTTCATAGACCCTCTTCTGACCCAAACTGCTTGGT
CCACGCTTACTTTTAGTGCGTATATGTGCTGCTCCTGTGATGTTTTCATGGTAATAACATTGAACCTAGATCTCA
CTCTCATCTCACCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTCTCGCCGCCTGACGATTTTT
CTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTCCCAC
AAAATGCGTCTAATGGCATTCAATCTTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAATTGCC
TTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTTATGG
TCGCAGTCGTGTTCAAGTACACCTCCCGTACGGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCCTTCA
ATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGAGATG
AAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGATCAC
ACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAATTTGGTCCGTA
TTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTCAGTC
GCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCATATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTGAAAG
TGACATTTACGACAACCAACAAACTATATGATGAAACACGGACATTGTTATCTCTTGGGCCTTTGTATAACCATT
ACAGGCATGGTTCGCAGATGTTTGCAACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGCGCTG
GGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGTATTT
GGCTGCCATGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATTGCGG
TTCTTTTGGTCATCCTGACACCGACGGTCCGTGCTTCCTTTTCAACCATCTAATTCTATGCTTACCCCAATTTCT
CTGACCCAGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATACTCATCATTCTTGCACTCGTT
TATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGTATTGTTGGTGGTTTGGGCTTT
GATCGTAGTCGACATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTGGGCTGGTGCGGATTCCGATCC
CACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCTCAGGGGCTACCCGAAATGAGC
CCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCTGATAGCAGGAAAGCTTCGACA
CATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCATATCGAGAGGATGATGATGAT
GAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATGCTCCAGTTGCGGAGCCTGCTCCT
ACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCACATATCGATACTCCGTATGCT
ATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCCATTGCTAGTTCATCTATGCAT
GCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAAGATGGATCATTTTATCGGGGA
TATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGATCCACAACCTTCGTTATCATCT
CTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATGCAACCTGCTCACGTGCGTACA
AAGTCGCAGACCGCCATAATTGAAGATGCGAGTAAAGTGTATGGCCTCGCCGCTACTCTGACGGTTAACCCCAGC
GGGTCTTCTAATAGTAATTCTGAGGGCGGCGTAGGCGCTGTCCGGCCACCGCGGTTTTCTGTTAGTGTGGACGAT
GACGACGACGACGATAGTAGTACTATTGAAGAACAACCGAAGAAGAAGCCGTGGTACCGTATTGGCCGACGGCGG
CCCGATGGTAGTGATGGTCCTTCATCTTCATCGTCGACTGCAGCGCCCGCTGTGGACTCCGAATTGGGTGGCATG
TCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCACAGCCAACAAGGTCGTTTGTT
GTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAATGCGAGCCGGCTTCAGAATACA
ACTTACCCTCCATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail