Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|068330
Gene name
Locationscaffold_04:918464..919884
Strand+
Gene length (bp)1420
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 5.2E-08 232 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 195 305 3.0E-07
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 206 307 4.0E-07
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 224 313 8.0E-07
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 231 286 1.0E-06
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 215 284 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 195 305 3.0E-07
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 206 307 4.0E-07
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 224 313 8.0E-07
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 231 286 1.0E-06
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 215 284 2.0E-06
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 218 294 2.0E-06
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 232 284 2.0E-06
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 232 273 4.0E-06
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 232 284 4.0E-06
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 232 284 7.0E-06
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 232 284 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|068330
MDSATFDPYASYSDSSAPHTPEPLPTDMHYCKTNVDDAVRNIFTHPDDSHPDGQYWSHPTFFNSQRGSLLQELYD
EQQPPASDVYPDHFVTHPVHQQQLSSRPHDYQMMRRNTFPTVRYDRDDGLPAQQYPPFIQQSHHYQRNGPLYSEQ
LNLTAEPAPIPSETYLPAAYDDASNIKLEDPGTLMVPSHSFYRPQSSGGLMGVPFVPPHSGLHVQHTDDAASKET
QYLRRRCFNCHTTEPPSWRRSTLNPGKIVCNKCGLYERTHLRPRPLRFDELRAGHKPRKQSKGTASPKAKLSPIV
KKEPREPGLTRRSSVSSSSGSVHSGSGASDWDDNVSIYSGSNPPTSFNSPNVQTFPLSRDSHSPPHDGGIRLPNA
PLSDIASLQQSHQPSTPSLAPSTPHSGHSSPGYYSPPATSPNAGVQSPEYYHHDAVTTVSGPWTEAPSGILSSPI
PTPVAS*
Coding >Agabi119p4|068330
ATGGACTCTGCCACCTTCGACCCCTACGCCTCCTACTCCGACAGCTCCGCTCCCCACACCCCAGAGCCTCTCCCC
ACAGACATGCACTACTGCAAGACAAACGTCGACGACGCCGTCCGCAACATCTTCACCCACCCCGACGACTCCCAT
CCAGACGGCCAGTATTGGTCCCACCCCACCTTTTTCAATTCGCAGCGTGGTTCCCTTTTGCAGGAACTCTATGAC
GAGCAACAGCCTCCTGCTTCGGACGTCTATCCCGATCACTTTGTGACTCATCCTGTCCACCAACAGCAGTTATCG
TCGCGTCCGCACGACTACCAGATGATGCGACGCAATACCTTTCCCACTGTTCGCTACGACCGCGACGATGGCCTG
CCTGCGCAACAATATCCCCCTTTCATCCAGCAATCCCATCACTATCAGCGCAACGGCCCCCTTTATTCCGAGCAA
CTCAACTTGACTGCTGAGCCTGCCCCAATCCCATCCGAAACTTACCTCCCCGCCGCTTACGACGATGCCTCTAAT
ATCAAGTTGGAGGATCCTGGCACGTTAATGGTTCCCTCCCATTCCTTCTACCGTCCCCAATCATCTGGTGGCCTC
ATGGGTGTCCCTTTCGTGCCTCCCCACAGTGGACTACATGTCCAGCATACTGATGATGCCGCTTCGAAAGAGACT
CAATACCTTCGTCGCCGCTGCTTCAACTGCCATACCACAGAGCCCCCCTCGTGGCGTCGCTCTACTCTTAATCCC
GGAAAAATCGTCTGCAACAAATGCGGGCTCTATGAGCGCACTCACCTGAGACCGCGCCCTCTTCGCTTTGACGAG
CTCCGCGCTGGCCACAAGCCCCGAAAACAATCTAAAGGAACCGCCAGCCCCAAAGCGAAGCTGAGTCCCATCGTG
AAGAAAGAGCCTCGTGAACCCGGCCTCACGCGGCGCTCCTCTGTCTCATCCTCTTCTGGCTCTGTCCACTCAGGG
AGTGGCGCCAGCGACTGGGATGACAATGTCTCCATCTATTCAGGCTCCAACCCTCCCACCTCCTTCAACTCTCCT
AATGTCCAGACTTTCCCTCTTTCTCGCGATTCCCACTCTCCCCCGCATGACGGAGGTATTCGCTTGCCGAATGCC
CCATTGTCAGACATTGCCTCCCTCCAACAATCCCACCAACCATCGACGCCCTCTCTTGCTCCCTCAACCCCTCAT
TCTGGCCATTCCTCGCCAGGTTATTACTCCCCTCCAGCGACTAGTCCCAACGCTGGTGTCCAGTCGCCGGAATAT
TACCATCATGATGCCGTGACAACAGTCTCGGGACCTTGGACAGAAGCCCCTAGTGGAATCCTGAGTAGCCCCATT
CCTACTCCTGTAGCGTCGTAG
Transcript >Agabi119p4|068330
ATGGACTCTGCCACCTTCGACCCCTACGCCTCCTACTCCGACAGCTCCGCTCCCCACACCCCAGAGCCTCTCCCC
ACAGACATGCACTACTGCAAGACAAACGTCGACGACGCCGTCCGCAACATCTTCACCCACCCCGACGACTCCCAT
CCAGACGGCCAGTATTGGTCCCACCCCACCTTTTTCAATTCGCAGCGTGGTTCCCTTTTGCAGGAACTCTATGAC
GAGCAACAGCCTCCTGCTTCGGACGTCTATCCCGATCACTTTGTGACTCATCCTGTCCACCAACAGCAGTTATCG
TCGCGTCCGCACGACTACCAGATGATGCGACGCAATACCTTTCCCACTGTTCGCTACGACCGCGACGATGGCCTG
CCTGCGCAACAATATCCCCCTTTCATCCAGCAATCCCATCACTATCAGCGCAACGGCCCCCTTTATTCCGAGCAA
CTCAACTTGACTGCTGAGCCTGCCCCAATCCCATCCGAAACTTACCTCCCCGCCGCTTACGACGATGCCTCTAAT
ATCAAGTTGGAGGATCCTGGCACGTTAATGGTTCCCTCCCATTCCTTCTACCGTCCCCAATCATCTGGTGGCCTC
ATGGGTGTCCCTTTCGTGCCTCCCCACAGTGGACTACATGTCCAGCATACTGATGATGCCGCTTCGAAAGAGACT
CAATACCTTCGTCGCCGCTGCTTCAACTGCCATACCACAGAGCCCCCCTCGTGGCGTCGCTCTACTCTTAATCCC
GGAAAAATCGTCTGCAACAAATGCGGGCTCTATGAGCGCACTCACCTGAGACCGCGCCCTCTTCGCTTTGACGAG
CTCCGCGCTGGCCACAAGCCCCGAAAACAATCTAAAGGAACCGCCAGCCCCAAAGCGAAGCTGAGTCCCATCGTG
AAGAAAGAGCCTCGTGAACCCGGCCTCACGCGGCGCTCCTCTGTCTCATCCTCTTCTGGCTCTGTCCACTCAGGG
AGTGGCGCCAGCGACTGGGATGACAATGTCTCCATCTATTCAGGCTCCAACCCTCCCACCTCCTTCAACTCTCCT
AATGTCCAGACTTTCCCTCTTTCTCGCGATTCCCACTCTCCCCCGCATGACGGAGGTATTCGCTTGCCGAATGCC
CCATTGTCAGACATTGCCTCCCTCCAACAATCCCACCAACCATCGACGCCCTCTCTTGCTCCCTCAACCCCTCAT
TCTGGCCATTCCTCGCCAGGTTATTACTCCCCTCCAGCGACTAGTCCCAACGCTGGTGTCCAGTCGCCGGAATAT
TACCATCATGATGCCGTGACAACAGTCTCGGGACCTTGGACAGAAGCCCCTAGTGGAATCCTGAGTAGCCCCATT
CCTACTCCTGTAGCGTCGTAG
Gene >Agabi119p4|068330
ATGGACTCTGCCACCTTCGACCCCTACGCCTCCTACTCCGACAGCTCCGCTCCCCACACCCCAGAGCCTCTCCCC
ACAGACATGCACTACTGCAAGACAAACGTCGACGACGCCGTCCGCAACATCTTCACCCACCCCGACGACTCCCAT
CCAGACGGCCAGTATTGGTCCCACCCCACCTTTTTCAATTCGCAGCGTGGTTCCCTTTTGCAGGAACTCTATGAC
GAGCAACAGCCTCCTGCTTCGGACGTCTATCCCGATCACTTTGTGACTCATCCTGTCCACCAACAGCAGTTATCG
TCGCGTCCGCACGACTACCAGATGATGCGACGCAATACCTTTCCCACTGTTCGCTACGACCGCGACGATGGCCTG
CCTGCGCAACAATATCCCCCTTTCATCCAGCAATCCCATCACTATCAGCGCAACGGCCCCCTTTATTCCGAGCAA
CTCAACTTGACTGCTGAGCCTGCCCCAATCCCATCCGAAACTTACCTCCCCGCCGCTTACGACGATGCCTCTAAT
ATCAAGTTGGAGGATCCTGGCACGTTAATGGTTCCCTCCCATTCCTTCTACCGTCCCCAATCATCTGGTGGCCTC
ATGGGTGTCCCTTTCGTGCCTCCCCACAGTGGACTACATGTCCAGCATACTGATGATGCCGCTTCGAAAGAGACT
CAATACCTTCGTCGCCGCTGCTTCAACTGCCATACCACAGAGCCCCCCTCGTGGCGTCGCTCTACTCTTAATCCC
GGAAAAATCGTCTGCAACAAATGCGGGCTCTATGAGCGCACTCACCTGAGACCGCGCCCTCTTCGCTTTGACGAG
CTCCGCGCTGGCCACAAGCCCCGAAAACAATCTAAAGGAACCGCCAGCCCCAAAGCGAAGCTGAGTCCCATCGTG
AAGAAAGAGCCTCGTGAACCCGGCCTCACGCGGCGCTCCTCTGTCTCATCCTCTTCTGGCTCTGTCCACTCAGGG
AGTGGCGCCAGCGACTGGGATGACAATGGTGAGTTTACTTTGGCAAATACTGTTTACTCTCATATTGATAAAAGT
AGTCTCCATCTATTCAGGCTCCAACCCTCCCACCTCCTTCAACTCTCCTAATGTCCAGACTTTCCCTCTTTCTCG
CGATTCCCACTCTCCCCCGCATGACGGAGGTATTCGCTTGCCGAATGCCCCATTGTCAGACATTGCCTCCCTCCA
ACAATCCCACCAACCATCGACGCCCTCTCTTGCTCCCTCAACCCCTCATTCTGGCCATTCCTCGCCAGGTTATTA
CTCCCCTCCAGCGACTAGTCCCAACGCTGGTGTCCAGTCGCCGGAATATTACCATCATGATGCCGTGACAACAGT
CTCGGGACCTTGGACAGAAGCCCCTAGTGGAATCCTGAGTAGCCCCATTCCTACTCCTGTAGCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail