Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|068230
Gene name
Locationscaffold_04:892919..895273
Strand-
Gene length (bp)2354
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term 1.0E-71 357 698
PF13661 2OG-FeII_Oxy_4 2OG-Fe(II) oxygenase superfamily 1.4E-32 194 305
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 1.1E-13 194 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 74 694 1.0E-94
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 80 708 1.0E-92
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 94 694 8.0E-72
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 81 395 2.0E-24
sp|Q3U0K8|OGFD1_MOUSE Prolyl 3-hydroxylase OGFOD1 OS=Mus musculus GN=Ogfod1 PE=1 SV=1 85 395 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 74 694 1.0E-94
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 80 708 1.0E-92
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 94 694 8.0E-72
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 81 395 2.0E-24
sp|Q3U0K8|OGFD1_MOUSE Prolyl 3-hydroxylase OGFOD1 OS=Mus musculus GN=Ogfod1 PE=1 SV=1 85 395 3.0E-24
sp|Q5R4R3|OGFD1_PONAB Prolyl 3-hydroxylase OGFOD1 OS=Pongo abelii GN=OGFOD1 PE=2 SV=1 81 395 5.0E-24
sp|Q3MI03|OGFD1_BOVIN Prolyl 3-hydroxylase OGFOD1 OS=Bos taurus GN=OGFOD1 PE=2 SV=2 81 395 1.0E-23
sp|Q6DE73|OGFD1_XENLA Prolyl 3-hydroxylase OGFOD1 OS=Xenopus laevis GN=ogfod1 PE=2 SV=1 102 406 7.0E-20
sp|Q9I7H9|OGFD1_DROME Prolyl 3-hydroxylase sudestada1 OS=Drosophila melanogaster GN=sud1 PE=2 SV=1 127 394 6.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0031418 L-ascorbic acid binding Yes
GO:0016706 2-oxoglutarate-dependent dioxygenase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031406 carboxylic acid binding No
GO:0030246 carbohydrate binding No
GO:0048029 monosaccharide binding No
GO:0036094 small molecule binding No
GO:0051213 dioxygenase activity No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0016491 oxidoreductase activity No
GO:0043168 anion binding No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043177 organic acid binding No
GO:0046914 transition metal ion binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|068230
MDQKILRDMGRVEEWNTRRYLRKGASRGTRRAWPPHQIHQRKQCTIYFVEKTYQENIDPAKHIKRLKAVVDDMPS
SSSSFAANLFDHNTIAAHNNSYHNNSPFKHSVIDKLFQDDLLSKVKDECLSINFTEKQTDIYKVHQTGDLASLNY
IKPEERDQLANLLTLRDALYSAQFRNFLRVVTGCGPLSGIKQDMSVNSYRKGCHLLNHDDVISSRRVSYILYMPI
TPRHIWRKEWGGALELYPVIKGEDGTPVPDVTPSKIIPPSWNQFVFFEVQPGKSFHSVEEVIVGGEGDNRNRLSI
SGWFHAAQPGEEGYVPEQNSTYKSSREQLQTTSIEFRPYTPTDEEALAFATTLSDDHIAFLSEFLNPVYLQPRTM
QALSARFVEESSLELHQFLNNPLSQALQPRLRELDVKDGLGPDRPLTIPNHTAGVAWQPPTGVDRASYFNTRPHS
NDRTRSPSFSPNPNWIIRGPPHKWRYCTLSPKSLHKLEAVTPRSAHASPVEIMRSLQDELFPSDAFRAWLAIVAG
LVPMGWICEARRFRPGLDYTLATSEANEARLDVVLGLTPELCDIKGSRGNSKDVQTNDWQSSDWGGWECYMAPHN
EDDDPTVYKSGNSSQLRNENIRQRSSKSNTEDADQMEVEEEADTYGNDDDSTLLTVHPGFNRLLLVLRDEKVMRF
VKYVSASAEGSRWDVCAEYEVGALQPDDDDDDAQEG*
Coding >Agabi119p4|068230
ATGGATCAAAAGATACTGCGGGACATGGGTCGCGTGGAAGAATGGAATACACGGCGATACTTAAGGAAAGGAGCC
TCGAGAGGAACTAGACGAGCCTGGCCCCCTCATCAAATCCATCAACGAAAACAGTGTACAATTTATTTTGTAGAA
AAAACATATCAAGAGAACATCGATCCTGCAAAACATATCAAGCGCCTCAAGGCGGTCGTGGACGACATGCCCTCC
TCCAGCTCCAGCTTCGCTGCTAACCTCTTTGATCACAACACCATTGCTGCCCACAACAACTCGTACCACAACAAT
TCCCCTTTCAAGCACTCTGTCATAGACAAACTCTTCCAGGATGATCTTCTTTCCAAGGTCAAGGACGAATGTTTG
AGCATCAACTTTACCGAAAAGCAAACGGATATCTACAAGGTTCACCAAACCGGTGACCTCGCCTCCCTCAATTAT
ATCAAGCCCGAGGAGCGAGACCAGCTTGCAAATCTCTTGACTCTCCGCGATGCGCTCTACTCAGCCCAGTTCCGC
AACTTTCTTCGAGTTGTCACTGGATGCGGTCCTCTTTCTGGCATCAAACAGGACATGTCTGTCAACTCGTACAGA
AAGGGCTGTCACCTTCTCAATCACGACGATGTCATTAGTTCTCGACGCGTCTCTTACATACTGTACATGCCTATT
ACCCCCCGTCATATATGGCGGAAGGAATGGGGCGGCGCCCTGGAGCTCTATCCTGTGATCAAGGGTGAGGATGGC
ACACCCGTTCCCGACGTGACACCTTCAAAAATCATCCCGCCGAGTTGGAATCAATTTGTTTTCTTCGAGGTTCAG
CCAGGTAAAAGCTTCCATTCTGTAGAAGAAGTCATCGTTGGAGGTGAAGGCGACAATCGTAACCGGCTTAGTATC
AGTGGATGGTTCCATGCCGCGCAACCGGGTGAAGAAGGCTATGTGCCCGAGCAGAATTCTACCTACAAAAGCTCC
AGAGAGCAGCTTCAAACAACAAGTATCGAGTTCAGACCCTATACGCCCACCGATGAAGAAGCTCTCGCCTTTGCT
ACAACCTTATCCGATGATCATATCGCATTTCTCTCGGAGTTCCTCAACCCGGTGTACCTCCAGCCTAGGACCATG
CAGGCACTCTCAGCTCGCTTCGTCGAAGAATCTTCTCTTGAATTGCACCAATTTCTAAATAACCCGCTATCACAG
GCTCTTCAACCTCGTTTGCGCGAATTGGATGTGAAGGACGGTCTAGGTCCTGATCGGCCACTAACCATCCCAAAC
CACACCGCAGGAGTCGCCTGGCAGCCGCCAACGGGTGTTGATCGCGCTTCATATTTCAATACACGCCCCCATAGC
AATGATCGCACAAGAAGTCCCAGTTTCTCTCCAAATCCAAACTGGATAATCCGTGGCCCACCGCACAAGTGGCGC
TACTGCACCCTTTCCCCAAAATCGCTACATAAACTTGAAGCTGTCACACCACGCTCAGCACATGCATCCCCTGTT
GAAATCATGCGATCACTTCAAGATGAACTCTTCCCTTCCGATGCTTTTCGTGCATGGCTGGCTATTGTTGCTGGG
CTGGTGCCTATGGGGTGGATATGCGAAGCTAGACGATTTAGACCTGGTTTAGACTACACTTTGGCGACGAGTGAA
GCGAACGAGGCAAGGCTAGATGTTGTTCTTGGGTTGACACCCGAGTTGTGTGACATCAAAGGCTCGCGAGGAAAC
AGTAAGGATGTCCAAACGAACGATTGGCAAAGCTCTGATTGGGGTGGTTGGGAGTGTTATATGGCTCCTCACAAC
GAGGATGACGATCCCACCGTATATAAATCTGGGAATAGCAGCCAACTTCGAAATGAAAACATTCGGCAACGTTCC
TCGAAGTCAAATACCGAAGATGCAGATCAAATGGAGGTAGAAGAAGAAGCAGATACATATGGAAATGACGATGAT
AGTACACTGTTGACAGTGCATCCTGGATTTAATCGGCTGCTTTTGGTGTTGAGAGATGAGAAGGTGATGAGGTTT
GTGAAGTATGTTTCTGCTTCTGCGGAGGGATCTCGATGGGATGTATGTGCTGAGTACGAGGTGGGCGCACTTCAA
CCGGATGATGATGATGATGACGCCCAAGAAGGATGA
Transcript >Agabi119p4|068230
ATGGATCAAAAGATACTGCGGGACATGGGTCGCGTGGAAGAATGGAATACACGGCGATACTTAAGGAAAGGAGCC
TCGAGAGGAACTAGACGAGCCTGGCCCCCTCATCAAATCCATCAACGAAAACAGTGTACAATTTATTTTGTAGAA
AAAACATATCAAGAGAACATCGATCCTGCAAAACATATCAAGCGCCTCAAGGCGGTCGTGGACGACATGCCCTCC
TCCAGCTCCAGCTTCGCTGCTAACCTCTTTGATCACAACACCATTGCTGCCCACAACAACTCGTACCACAACAAT
TCCCCTTTCAAGCACTCTGTCATAGACAAACTCTTCCAGGATGATCTTCTTTCCAAGGTCAAGGACGAATGTTTG
AGCATCAACTTTACCGAAAAGCAAACGGATATCTACAAGGTTCACCAAACCGGTGACCTCGCCTCCCTCAATTAT
ATCAAGCCCGAGGAGCGAGACCAGCTTGCAAATCTCTTGACTCTCCGCGATGCGCTCTACTCAGCCCAGTTCCGC
AACTTTCTTCGAGTTGTCACTGGATGCGGTCCTCTTTCTGGCATCAAACAGGACATGTCTGTCAACTCGTACAGA
AAGGGCTGTCACCTTCTCAATCACGACGATGTCATTAGTTCTCGACGCGTCTCTTACATACTGTACATGCCTATT
ACCCCCCGTCATATATGGCGGAAGGAATGGGGCGGCGCCCTGGAGCTCTATCCTGTGATCAAGGGTGAGGATGGC
ACACCCGTTCCCGACGTGACACCTTCAAAAATCATCCCGCCGAGTTGGAATCAATTTGTTTTCTTCGAGGTTCAG
CCAGGTAAAAGCTTCCATTCTGTAGAAGAAGTCATCGTTGGAGGTGAAGGCGACAATCGTAACCGGCTTAGTATC
AGTGGATGGTTCCATGCCGCGCAACCGGGTGAAGAAGGCTATGTGCCCGAGCAGAATTCTACCTACAAAAGCTCC
AGAGAGCAGCTTCAAACAACAAGTATCGAGTTCAGACCCTATACGCCCACCGATGAAGAAGCTCTCGCCTTTGCT
ACAACCTTATCCGATGATCATATCGCATTTCTCTCGGAGTTCCTCAACCCGGTGTACCTCCAGCCTAGGACCATG
CAGGCACTCTCAGCTCGCTTCGTCGAAGAATCTTCTCTTGAATTGCACCAATTTCTAAATAACCCGCTATCACAG
GCTCTTCAACCTCGTTTGCGCGAATTGGATGTGAAGGACGGTCTAGGTCCTGATCGGCCACTAACCATCCCAAAC
CACACCGCAGGAGTCGCCTGGCAGCCGCCAACGGGTGTTGATCGCGCTTCATATTTCAATACACGCCCCCATAGC
AATGATCGCACAAGAAGTCCCAGTTTCTCTCCAAATCCAAACTGGATAATCCGTGGCCCACCGCACAAGTGGCGC
TACTGCACCCTTTCCCCAAAATCGCTACATAAACTTGAAGCTGTCACACCACGCTCAGCACATGCATCCCCTGTT
GAAATCATGCGATCACTTCAAGATGAACTCTTCCCTTCCGATGCTTTTCGTGCATGGCTGGCTATTGTTGCTGGG
CTGGTGCCTATGGGGTGGATATGCGAAGCTAGACGATTTAGACCTGGTTTAGACTACACTTTGGCGACGAGTGAA
GCGAACGAGGCAAGGCTAGATGTTGTTCTTGGGTTGACACCCGAGTTGTGTGACATCAAAGGCTCGCGAGGAAAC
AGTAAGGATGTCCAAACGAACGATTGGCAAAGCTCTGATTGGGGTGGTTGGGAGTGTTATATGGCTCCTCACAAC
GAGGATGACGATCCCACCGTATATAAATCTGGGAATAGCAGCCAACTTCGAAATGAAAACATTCGGCAACGTTCC
TCGAAGTCAAATACCGAAGATGCAGATCAAATGGAGGTAGAAGAAGAAGCAGATACATATGGAAATGACGATGAT
AGTACACTGTTGACAGTGCATCCTGGATTTAATCGGCTGCTTTTGGTGTTGAGAGATGAGAAGGTGATGAGGTTT
GTGAAGTATGTTTCTGCTTCTGCGGAGGGATCTCGATGGGATGTATGTGCTGAGTACGAGGTGGGCGCACTTCAA
CCGGATGATGATGATGATGACGCCCAAGAAGGATGA
Gene >Agabi119p4|068230
ATGGATCAAAAGATACTGCGGGACATGGGTCGCGTGGAAGAATGGAATACACGGCGATACTTAAGGAAAGGAGCC
TCGAGAGGAACTAGACGAGCCTGGCCCCCTCATCAAATCCATCAACGAAAACAGTGTACAATTTATTTTGTAGAA
AAAACATATCAAGGTGCCGGCGCTTGACCTCTTCTACCAATGCCTGGCACTCACGCCCGAGACTTTTCTCCAGAG
AACATCGATCCTGCAAAACATATCAAGCGCCTCAAGGCGGTCGTGGACGACATGCCCTCCTCCAGCTCCAGCTTC
GCTGCTAACCTCTTTGATCACAACACCATTGCTGCCCACAACAACTCGTACCACAACAATTCCCCTTTCAAGCAC
TCTGTCATAGACAAACTCTTCCAGGATGATCTTCTTTCCAAGGTCAAGGACGAATGTTTGAGCATCAACTTTACC
GAAAAGCAAACGGATATCTACAAGGTGGGTCTCTATTTCTACTCCGGCCCCTCATTTTTGATTTTGCGCCAGGTT
CACCAAACCGGTGACCTCGCCTCCCTCAATTATATCAAGCCCGAGGAGCGAGACCAGCTTGCAAATCTCTTGACT
CTCCGCGATGCGCTCTACTCAGCCCAGTTCCGCAACTTTCTTCGAGTTGTCACTGGATGCGGTCCTCTTTCTGGC
ATCAAACAGGACATGTCTGTCAACTCGTACAGAAAGGGCTGTCACCTTCTCAATCACGACGATGTCATTAGTTCT
CGACGCGTCTCTTACATACTGTACATGCCTATTACCCCCCGTCATATATGGCGGAAGGAATGGGGCGGCGCCCTG
GAGCTCTATCCTGTGATCAAGGGTGAGGATGGCACACCCGTTCCCGACGTGACACCTTCAAAAATCATCCCGCCG
AGTTGGAATCAATTTGTTTTCTTCGAGGTTCAGCCAGGTAAAAGCTTCCATTCTGTAGAAGAAGTCATCGTTGGA
GGTGAAGGCGACAATCGTAACCGGCTTAGTATCAGTGGATGGTTCCATGCCGCGCAACCGGGTGAAGAAGGCTAT
GTGCCCGAGCAGAATTCTACCTACAAAAGCTCCAGAGAGCAGCTTGTATGTATCCAATCTGATTCGAAAATTTTT
ATATCTTATACCGTGGTAGCAAACAACAAGTATCGAGTTCAGACCCTATACGCCCACCGATGAAGAAGCTCTCGC
CTTTGCTACAACCTTATCCGATGATCATATCGCATTTCTCTCGGAGTTCCTCAACCCGGTGTACCTCCAGCCTAG
GACCATGCAGGCACTCTCAGCTCGCTTCGTCGAAGAATCTTCTCTTGAATTGCACCAATTTCTAAATAACCCGCT
ATCACAGGCTCTTCAACCTCGTTTGCGCGAATTGGATGTGAAGGACGGTCTAGGTCCTGATCGGCCACTAACCAT
CCCAAACCACACCGCAGGAGTCGCCTGGCAGCCGCCAACGGGTGTTGATCGCGCTTCATATTTCAATACACGCCC
CCATAGCAATGATCGCACAAGAAGTCCCAGTTTCTCTCCAAATCCAAACTGGATAATCCGTGGCCCACCGCACAA
GTGGCGCTACTGCACCCTTTCCCCAAAATCGCTACATAAACTTGAAGCTGTCACACCACGCTCAGCACATGCATC
CCCTGTTGAAATCATGCGATCACTTCAAGATGAACTCTTCCCTTCCGATGCTTTTCGTGCATGGCTGGCTATTGT
TGCTGGGCTGGTGCCTATGGGGTGGATATGCGAAGCTAGACGATTTAGACCTGGTTTAGACTACACTTTGGCGAC
GAGTGAAGCGAACGAGGCAAGGCTAGATGTTGTTCTTGGGTTGACACCCGAGTTGTGTGACATCAAAGGCTCGCG
AGGAAACAGTAAGGATGTCCAAACGAACGATTGGCAAAGCTCTGATTGGGGTGGTTGGGAGGTGCGTCAACATGT
GTGGCTACCTTGAACTTGCTCGATTGATATTCGCCCCATGTCTCTAGTGTTATATGGCTCCTCACAACGAGGATG
ACGATCCCACCGTATATAAATCTGGGAATAGCAGCCAACTTCGAAATGAAAACATTCGGCAACGTTCCTCGAAGT
CAAATACCGAAGATGCAGATCAAATGGAGGTAGAAGAAGAAGCAGATACATATGGAAATGACGATGATAGTACAC
TGTTGACAGTGCATCCTGGATTTAATCGGCTGCTTTTGGTGTTGAGAGATGAGAAGGTGATGAGGTTTGTGAAGT
ATGTTTCTGCTTCTGCGGAGGGATCTCGATGGGATGTATGTGCTGAGTACGAGGTGGGCGCACTTCAACCGGATG
ATGATGATGATGACGCCCAAGAAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail