Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067800
Gene name
Locationscaffold_04:785195..786529
Strand+
Gene length (bp)1334
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04979 IPP-2 Protein phosphatase inhibitor 2 (IPP-2) 3.1E-14 58 255

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0009966 regulation of signal transduction Yes
GO:0043666 regulation of phosphoprotein phosphatase activity Yes
GO:0004864 protein phosphatase inhibitor activity Yes
GO:0050790 regulation of catalytic activity No
GO:0065009 regulation of molecular function No
GO:0019212 phosphatase inhibitor activity No
GO:0051246 regulation of protein metabolic process No
GO:0065007 biological regulation No
GO:0031399 regulation of protein modification process No
GO:0019888 protein phosphatase regulator activity No
GO:0019222 regulation of metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0048583 regulation of response to stimulus No
GO:0010921 regulation of phosphatase activity No
GO:0019208 phosphatase regulator activity No
GO:0003674 molecular_function No
GO:0080090 regulation of primary metabolic process No
GO:0051174 regulation of phosphorus metabolic process No
GO:0050794 regulation of cellular process No
GO:0023051 regulation of signaling No
GO:0051336 regulation of hydrolase activity No
GO:0035304 regulation of protein dephosphorylation No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0004857 enzyme inhibitor activity No
GO:0010646 regulation of cell communication No
GO:0008150 biological_process No
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0035303 regulation of dephosphorylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067800
MSSMEVATGNQQAQEQHQANNPSRQPSRSLSQTKPKGILKNAPHHAYNNNNNNTAHSLQWDEENLALTEIQKDSL
MKITEPKTPYVRYNAETDTIEGDIPDLHLGGQYYSESPPPQSPTQTLSSTGADTSGPSSRRTSISSVGFSNIVSV
EGGRAEPVIGVVAGTSGSISGGSHRSTGSNASSRSTSFNLPDEAKGGVREVGGDRGEEVEEDEEMDEEAAAKHAA
FVRARGRHYSNEAEAMKRAAQLMDEDDEDEGAQGDARNVGDNGNDDDEASGEYNAVGQGRSSIPPVPSLPGGEDA
AMTTTPKVNGIGHSDRHT*
Coding >Agabi119p4|067800
ATGTCATCCATGGAAGTAGCTACCGGCAATCAACAGGCGCAAGAGCAACACCAGGCGAATAATCCTTCACGACAA
CCCTCGAGGTCGTTATCACAAACGAAACCAAAGGGAATTCTCAAGAATGCACCTCATCACGCCTATAACAACAAT
AACAACAATACTGCACACAGTTTACAATGGGACGAAGAGAATCTTGCATTGACAGAGATTCAGAAGGATAGTTTG
ATGAAGATTACAGAACCAAAGACTCCTTATGTGAGATACAATGCTGAAACTGATACCATCGAAGGTGATATCCCG
GATTTGCACTTGGGAGGACAATACTATTCGGAATCGCCACCACCACAATCGCCTACACAGACATTGTCATCTACG
GGTGCAGATACTTCTGGACCTTCATCGAGACGTACATCTATCTCAAGTGTTGGATTTTCTAATATTGTCTCTGTT
GAAGGTGGAAGAGCTGAACCTGTCATTGGTGTAGTAGCAGGAACTTCTGGATCGATTTCTGGAGGAAGTCATAGG
TCTACTGGGAGTAATGCTTCCAGTAGGAGTACCAGTTTCAATTTGCCTGATGAAGCCAAGGGAGGGGTTAGAGAG
GTTGGTGGGGATAGAGGAGAAGAAGTTGAAGAAGATGAGGAGATGGACGAGGAAGCTGCTGCGAAACATGCGGCC
TTCGTTCGAGCCAGAGGCAGGCATTACTCAAACGAAGCTGAAGCTATGAAGCGTGCAGCACAACTTATGGATGAA
GATGACGAAGATGAAGGTGCTCAAGGTGACGCCAGGAATGTCGGTGATAACGGTAACGACGACGATGAGGCATCG
GGTGAATATAACGCTGTTGGTCAAGGAAGATCCTCTATTCCCCCTGTTCCGTCGCTTCCTGGCGGGGAGGACGCA
GCGATGACAACGACGCCAAAGGTTAATGGAATTGGACACTCGGATCGTCATACTTAG
Transcript >Agabi119p4|067800
ATGTCATCCATGGAAGTAGCTACCGGCAATCAACAGGCGCAAGAGCAACACCAGGCGAATAATCCTTCACGACAA
CCCTCGAGGTCGTTATCACAAACGAAACCAAAGGGAATTCTCAAGAATGCACCTCATCACGCCTATAACAACAAT
AACAACAATACTGCACACAGTTTACAATGGGACGAAGAGAATCTTGCATTGACAGAGATTCAGAAGGATAGTTTG
ATGAAGATTACAGAACCAAAGACTCCTTATGTGAGATACAATGCTGAAACTGATACCATCGAAGGTGATATCCCG
GATTTGCACTTGGGAGGACAATACTATTCGGAATCGCCACCACCACAATCGCCTACACAGACATTGTCATCTACG
GGTGCAGATACTTCTGGACCTTCATCGAGACGTACATCTATCTCAAGTGTTGGATTTTCTAATATTGTCTCTGTT
GAAGGTGGAAGAGCTGAACCTGTCATTGGTGTAGTAGCAGGAACTTCTGGATCGATTTCTGGAGGAAGTCATAGG
TCTACTGGGAGTAATGCTTCCAGTAGGAGTACCAGTTTCAATTTGCCTGATGAAGCCAAGGGAGGGGTTAGAGAG
GTTGGTGGGGATAGAGGAGAAGAAGTTGAAGAAGATGAGGAGATGGACGAGGAAGCTGCTGCGAAACATGCGGCC
TTCGTTCGAGCCAGAGGCAGGCATTACTCAAACGAAGCTGAAGCTATGAAGCGTGCAGCACAACTTATGGATGAA
GATGACGAAGATGAAGGTGCTCAAGGTGACGCCAGGAATGTCGGTGATAACGGTAACGACGACGATGAGGCATCG
GGTGAATATAACGCTGTTGGTCAAGGAAGATCCTCTATTCCCCCTGTTCCGTCGCTTCCTGGCGGGGAGGACGCA
GCGATGACAACGACGCCAAAGGTTAATGGAATTGGACACTCGGATCGTCATACTTAG
Gene >Agabi119p4|067800
ATGTCATCCATGGAAGTAGCTACCGGCAATCAACAGGCGCAAGAGCAACACCAGGCGAATAATCCTTCACGACAA
CCCTCGAGGTCGTTATCACAAACGAAACCAAAGGGAATTCTCAAGAATGCACCTCATCACGCCTATAACAACAAT
AACAACAATACTGCACAGTATGTTGTATTTCTTTTGGATTCTTATATGATTATCTGATGAAATATCTATCGATCT
TGTTTTTGCTTCGCCACCCGTTGTGCTGTAACAATATACGTGCCTACGACTCATCCTCGCTCGTTATCTTCAACA
TAAATCATGTGGCGCTTCTTTCGTTGTCGGCTGACGTTATTTTGGTTATTCTCCGGGGAATCATAGCAGTTTACA
ATGGGACGAAGAGAATCTTGCATTGACAGAGATTCAGAAGGATAGTTTGATGAAGATTACAGAACCAAAGACTCC
TTATGTGAGATACAATGCTGAAACTGATACCATCGAAGGTGGTAAGTGAAACACCCTTAATCCAAAATCTCCTTT
TGCTCAATCCCTCCCTTTTAATAAGATATCCCGGATTTGCACTTGGGAGGACAATACTATTCGGAATCGCCACCA
CCACAATCGCCTACACAGACATTGTCATCTACGGGTGCAGATACTTCTGGACCTTCATCGAGACGTACATCTATC
TCAAGTGTTGGATTTTCTAATATTGTCTCTGTTGAAGGTGGAAGAGCTGAACCTGTCATTGGTGTAGTAGCAGGA
ACTTCTGGATCGATTTCTGGAGGAAGTCATAGGTCTACTGGGAGTAATGCTTCCAGTAGGAGTACCAGTTTCAAT
TTGCCTGATGAAGCCAAGGGAGGGGTTAGAGAGGTTGGTGGGGATAGAGGAGAAGAAGTTGAAGAAGATGAGGAG
ATGGACGAGGAAGGTACGCGTTGTTTCCTTTAAGATCGTTTCTTCGAAATTTCTCATCGTATACCTCTCAACAGC
TGCTGCGAAACATGCGGCCTTCGTTCGAGCCAGAGGCAGGCATTACTCAAACGAAGCTGAAGCTATGAAGGTACA
GTGCACGATTTTGATTCAATGAGCGTTATTGACTCGGTATCTGTCTACCCCAGCGTGCAGCACAACTTATGGATG
AAGATGACGAAGATGAAGGTGCTCAAGGTGACGCCAGGAATGTCGGTGATAACGGTAACGACGACGATGAGGCAT
CGGGTGAATATAACGCTGTTGGTCAAGGAAGATCCTCTATTCCCCCTGTTCCGTCGCTTCCTGGCGGGGAGGACG
CAGCGATGACAACGACGCCAAAGGTTAATGGAATTGGACACTCGGATCGTCATACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail