Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067720
Gene name
Locationscaffold_04:768726..771207
Strand+
Gene length (bp)2481
Transcript length (bp)2418
Coding sequence length (bp)2418
Protein length (aa) 806

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09405 Btz CASC3/Barentsz eIF4AIII binding 2.9E-11 213 318

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0035145 exon-exon junction complex Yes
GO:0006397 mRNA processing Yes
GO:0003729 mRNA binding Yes
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0032991 protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0003723 RNA binding No
GO:0005488 binding No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0016071 mRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067720
MPAPLTSSPPRSASPKAMHKSRTRMPRSRLIRRRGRARDGIESDDEIERVLSTDSESDSDSPLSPDSETDSDQES
ASEDGILNKQANDHTPDTSHSSGAPKTEVASNGKTDGALFSTSGDWSEMVADEGLNGSADLPVIEFSDFKETNVH
PTKVPQRREKRTNKKKIQTPLPIPATQPKEPASESVGTDAVEKVDEQPQDTSHPQPSHLRRPFGQSARQAYQRRL
ESDPSFVPKVGGFWGHDDRLMDRELRSLSGWWRGKWQGRARGRAGYPVGNGRPVLHQNEAPKEENANLPPIERAW
THDGFEEMRRKEDQRTELRAQHPATGSPLRGAPRGRGNLIAGRAGCGGLPRGGFVNSESRAAAAAKAGRVWYAMK
PELMWTKQSENFLFFESSKHRTGTAFRIQLPGSRSQVIKAPPAPVVVPKHVTVTTASVAGSDVGDMAFVVNLPSK
EEITVDETPLDDVFTVRPRLVNVEPIPLPAPSNTKSTKSSSPADKPTQSSEPSTSATSRDAAIRTQLEQLSLEPA
STDPTHWAQTEEAVLRKPAGGDPAGEATEAPSSEGAPRRPSLPPIQTVYSPPPAQPSPAYPSTYSYPTLPPGIAL
NLHGVPYEVATGRPVYIPPPVYNSRPIMHSHMPQQSISYMSTPHMHPSPAIASDFAHHPPSHPHTPSGPANGFLD
PATGAPVFSFPRAARVEIRAPGDDGSESLQNGNVKSSNSPSHSGVEYGYHSYGSSSDAGTLPSYAPLPDANAPSD
ATSNAPPPQAMMQYPAYQQYYYPEAPYGYTQYVGVSQTGQYEMYVPMEVHGTTYY*
Coding >Agabi119p4|067720
ATGCCTGCTCCTTTGACCTCATCTCCGCCGCGCTCAGCCAGTCCGAAGGCCATGCACAAGTCTCGCACTCGTATG
CCCAGGTCAAGACTCATCAGACGCCGAGGCCGTGCTAGAGATGGAATCGAGAGCGACGATGAGATAGAGCGAGTG
CTTTCGACCGACTCAGAGTCAGATTCGGATTCACCACTATCGCCTGACTCAGAGACCGATTCAGACCAGGAATCC
GCATCCGAGGACGGGATCTTAAACAAACAGGCCAATGACCACACGCCTGACACCAGTCATAGCTCCGGCGCTCCA
AAGACGGAAGTTGCTTCCAATGGAAAGACGGATGGTGCTTTGTTTTCGACTTCTGGTGACTGGTCAGAAATGGTG
GCTGACGAGGGTTTAAACGGTTCTGCGGACTTGCCTGTCATTGAATTCTCGGATTTCAAGGAGACCAATGTACAT
CCAACGAAGGTTCCACAACGGAGGGAGAAGAGGACGAACAAGAAAAAGATCCAAACACCGCTTCCAATCCCTGCT
ACTCAACCCAAAGAGCCTGCATCCGAATCTGTTGGGACTGATGCCGTAGAGAAGGTAGATGAGCAACCTCAGGAT
ACCAGCCACCCTCAACCCTCTCACCTCAGGCGTCCATTTGGTCAGAGCGCTCGTCAAGCATACCAGCGGAGATTG
GAGAGTGACCCCTCTTTCGTCCCAAAAGTAGGAGGTTTCTGGGGCCACGACGATCGGCTGATGGATAGGGAATTA
CGCAGTCTGAGTGGATGGTGGAGAGGCAAGTGGCAAGGCAGGGCCAGAGGAAGGGCAGGTTATCCAGTTGGAAAC
GGTAGGCCTGTGTTACACCAGAACGAGGCTCCCAAAGAAGAGAACGCAAATCTGCCTCCGATCGAACGAGCTTGG
ACACATGATGGTTTCGAGGAAATGAGGCGGAAGGAGGACCAGCGTACTGAACTTCGAGCTCAACATCCCGCTACC
GGCTCACCGTTGCGTGGTGCTCCTCGTGGCAGGGGCAATTTGATCGCTGGCCGTGCTGGCTGTGGCGGTCTGCCT
CGTGGCGGATTTGTCAACTCAGAAAGTCGGGCTGCGGCTGCGGCCAAAGCAGGTCGCGTCTGGTATGCTATGAAG
CCTGAGCTCATGTGGACCAAGCAAAGCGAAAACTTTCTTTTCTTCGAGTCCTCCAAGCATCGAACAGGAACCGCC
TTTCGCATCCAACTTCCTGGTTCACGTTCTCAAGTCATCAAAGCTCCTCCAGCTCCAGTAGTGGTGCCTAAACAT
GTAACAGTGACCACTGCAAGTGTAGCAGGTTCAGATGTTGGCGATATGGCCTTCGTTGTCAATCTTCCTAGTAAA
GAGGAAATCACTGTCGATGAGACTCCACTCGACGACGTCTTCACAGTGAGGCCGCGCCTTGTCAACGTTGAACCC
ATACCGCTCCCGGCTCCTTCCAACACCAAATCCACCAAATCGAGTTCTCCTGCCGACAAGCCTACCCAGTCCTCC
GAGCCATCTACCTCAGCTACAAGCCGAGATGCAGCCATTAGAACACAGCTCGAGCAACTCTCCCTCGAACCCGCT
TCGACGGACCCCACTCATTGGGCCCAAACGGAAGAGGCTGTGCTTCGTAAACCGGCAGGTGGAGATCCCGCAGGA
GAGGCGACAGAGGCTCCCTCTTCCGAAGGTGCTCCCCGACGTCCTTCTCTTCCTCCTATCCAAACTGTCTATAGC
CCCCCTCCCGCGCAACCTTCCCCCGCCTACCCATCCACCTACAGTTATCCCACACTACCGCCCGGGATTGCGCTT
AATCTCCATGGTGTTCCCTATGAAGTGGCGACTGGTCGTCCTGTGTATATACCTCCACCTGTCTACAACTCGCGG
CCTATCATGCACTCACACATGCCGCAACAGAGTATATCTTACATGTCGACGCCACATATGCATCCTTCTCCTGCC
ATCGCCTCTGATTTCGCTCATCACCCACCTTCACATCCCCATACTCCTTCAGGTCCTGCCAATGGCTTCCTTGAT
CCGGCGACCGGTGCTCCGGTGTTCTCTTTCCCTAGGGCAGCACGTGTGGAGATACGTGCACCAGGAGACGATGGT
AGCGAATCCCTTCAGAACGGCAACGTCAAGTCGTCCAACTCTCCATCTCACTCAGGAGTTGAGTATGGCTATCAT
TCATATGGTTCATCTTCAGATGCCGGCACACTACCTTCATACGCACCATTACCAGATGCGAATGCCCCATCGGAC
GCAACATCTAATGCACCACCACCACAAGCAATGATGCAGTATCCAGCGTATCAACAATACTATTATCCAGAAGCC
CCATATGGATATACGCAATATGTGGGCGTGTCGCAAACCGGGCAGTATGAAATGTATGTGCCTATGGAGGTACAT
GGCACAACCTATTATTAA
Transcript >Agabi119p4|067720
ATGCCTGCTCCTTTGACCTCATCTCCGCCGCGCTCAGCCAGTCCGAAGGCCATGCACAAGTCTCGCACTCGTATG
CCCAGGTCAAGACTCATCAGACGCCGAGGCCGTGCTAGAGATGGAATCGAGAGCGACGATGAGATAGAGCGAGTG
CTTTCGACCGACTCAGAGTCAGATTCGGATTCACCACTATCGCCTGACTCAGAGACCGATTCAGACCAGGAATCC
GCATCCGAGGACGGGATCTTAAACAAACAGGCCAATGACCACACGCCTGACACCAGTCATAGCTCCGGCGCTCCA
AAGACGGAAGTTGCTTCCAATGGAAAGACGGATGGTGCTTTGTTTTCGACTTCTGGTGACTGGTCAGAAATGGTG
GCTGACGAGGGTTTAAACGGTTCTGCGGACTTGCCTGTCATTGAATTCTCGGATTTCAAGGAGACCAATGTACAT
CCAACGAAGGTTCCACAACGGAGGGAGAAGAGGACGAACAAGAAAAAGATCCAAACACCGCTTCCAATCCCTGCT
ACTCAACCCAAAGAGCCTGCATCCGAATCTGTTGGGACTGATGCCGTAGAGAAGGTAGATGAGCAACCTCAGGAT
ACCAGCCACCCTCAACCCTCTCACCTCAGGCGTCCATTTGGTCAGAGCGCTCGTCAAGCATACCAGCGGAGATTG
GAGAGTGACCCCTCTTTCGTCCCAAAAGTAGGAGGTTTCTGGGGCCACGACGATCGGCTGATGGATAGGGAATTA
CGCAGTCTGAGTGGATGGTGGAGAGGCAAGTGGCAAGGCAGGGCCAGAGGAAGGGCAGGTTATCCAGTTGGAAAC
GGTAGGCCTGTGTTACACCAGAACGAGGCTCCCAAAGAAGAGAACGCAAATCTGCCTCCGATCGAACGAGCTTGG
ACACATGATGGTTTCGAGGAAATGAGGCGGAAGGAGGACCAGCGTACTGAACTTCGAGCTCAACATCCCGCTACC
GGCTCACCGTTGCGTGGTGCTCCTCGTGGCAGGGGCAATTTGATCGCTGGCCGTGCTGGCTGTGGCGGTCTGCCT
CGTGGCGGATTTGTCAACTCAGAAAGTCGGGCTGCGGCTGCGGCCAAAGCAGGTCGCGTCTGGTATGCTATGAAG
CCTGAGCTCATGTGGACCAAGCAAAGCGAAAACTTTCTTTTCTTCGAGTCCTCCAAGCATCGAACAGGAACCGCC
TTTCGCATCCAACTTCCTGGTTCACGTTCTCAAGTCATCAAAGCTCCTCCAGCTCCAGTAGTGGTGCCTAAACAT
GTAACAGTGACCACTGCAAGTGTAGCAGGTTCAGATGTTGGCGATATGGCCTTCGTTGTCAATCTTCCTAGTAAA
GAGGAAATCACTGTCGATGAGACTCCACTCGACGACGTCTTCACAGTGAGGCCGCGCCTTGTCAACGTTGAACCC
ATACCGCTCCCGGCTCCTTCCAACACCAAATCCACCAAATCGAGTTCTCCTGCCGACAAGCCTACCCAGTCCTCC
GAGCCATCTACCTCAGCTACAAGCCGAGATGCAGCCATTAGAACACAGCTCGAGCAACTCTCCCTCGAACCCGCT
TCGACGGACCCCACTCATTGGGCCCAAACGGAAGAGGCTGTGCTTCGTAAACCGGCAGGTGGAGATCCCGCAGGA
GAGGCGACAGAGGCTCCCTCTTCCGAAGGTGCTCCCCGACGTCCTTCTCTTCCTCCTATCCAAACTGTCTATAGC
CCCCCTCCCGCGCAACCTTCCCCCGCCTACCCATCCACCTACAGTTATCCCACACTACCGCCCGGGATTGCGCTT
AATCTCCATGGTGTTCCCTATGAAGTGGCGACTGGTCGTCCTGTGTATATACCTCCACCTGTCTACAACTCGCGG
CCTATCATGCACTCACACATGCCGCAACAGAGTATATCTTACATGTCGACGCCACATATGCATCCTTCTCCTGCC
ATCGCCTCTGATTTCGCTCATCACCCACCTTCACATCCCCATACTCCTTCAGGTCCTGCCAATGGCTTCCTTGAT
CCGGCGACCGGTGCTCCGGTGTTCTCTTTCCCTAGGGCAGCACGTGTGGAGATACGTGCACCAGGAGACGATGGT
AGCGAATCCCTTCAGAACGGCAACGTCAAGTCGTCCAACTCTCCATCTCACTCAGGAGTTGAGTATGGCTATCAT
TCATATGGTTCATCTTCAGATGCCGGCACACTACCTTCATACGCACCATTACCAGATGCGAATGCCCCATCGGAC
GCAACATCTAATGCACCACCACCACAAGCAATGATGCAGTATCCAGCGTATCAACAATACTATTATCCAGAAGCC
CCATATGGATATACGCAATATGTGGGCGTGTCGCAAACCGGGCAGTATGAAATGTATGTGCCTATGGAGGTACAT
GGCACAACCTATTATTAA
Gene >Agabi119p4|067720
ATGCCTGCTCCTTTGACCTCATCTCCGCCGCGCTCAGCCAGTCCGAAGGCCATGCACAAGTCTCGCACTCGTATG
CCCAGGTCAAGACTCATCAGACGCCGAGGCCGTGCTAGAGATGGAATCGAGAGCGACGATGAGATAGAGCGAGTG
CTTTCGACCGACTCAGAGTCAGATTCGGATTCACCACTATCGCCTGACTCAGAGACCGATTCAGACCAGGAATCC
GCATCCGAGGACGGGATCTTAAACAAACAGGCCAATGACCACACGCCTGACACCAGTCATAGCTCCGGCGCTCCA
AAGACGGAAGTTGCTTCCAATGGAAAGACGGATGGTGCTTTGTTTTCGACTTCTGGTGACTGGTCAGAAATGGTG
GCTGACGAGGGTTTAAACGGTTCTGCGGACTTGCCTGTCATTGAATTCTCGGATTTCAAGGAGACCAATGTACAT
CCAACGAAGGTTCCACAACGGAGGGAGAAGAGGACGAACAAGAAAAAGATCCAAACACCGCTTCCAATCCCTGCT
ACTCAACCCAAAGAGCCTGCATCCGAATCTGTTGGGACTGATGCCGTAGAGAAGGTAGATGAGCAACCTCAGGAT
ACCAGCCACCCTCAACCCTCTCACCTCAGGCGTCCATTTGGTCAGAGCGCTCGTCAAGCATACCAGCGGAGATTG
GAGAGTGACCCCTCTTTCGTCCCAAAAGTAGGAGGTTTCTGGGGCCACGACGATCGGCTGATGGATAGGGAATTA
CGCAGTCTGAGTGGATGGTGGAGAGGCAAGTGGCAAGGCAGGGCCAGAGGAAGGGCAGGTTATCCAGTTGGAAAC
GGTAGGCCTGTGTTACACCAGAACGAGGCTCCCAAAGAAGAGAACGCAAATCTGCCTCCGATCGAACGAGCTTGG
ACACATGATGGTTTCGAGGAAATGAGGCGGAAGGAGGACCAGCGTACTGAACTTCGAGCTCAACATCCCGCTACC
GGCTCACCGTTGCGTGGTGCTCCTCGTGGCAGGGGCAATTTGATCGCTGGCCGTGCTGGCTGTGGCGGTCTGCCT
CGTGGCGGATTTGTCAACTCAGAAAGTCGGGCTGCGGCTGCGGCCAAAGCAGGTCGCGTCTGGTATGCTATGAAG
CCTGAGCTCATGTGGACCAAGCAAAGCGAAAACTTTCTTTTCTTCGAGTCCTCCAAGCATCGAACAGGAACCGCC
TTTCGCATCCAACTTCCTGGTTCACGTTCTCAAGTCATCAAAGCTCCTCCAGCTCCAGTAGTGGTGCCTAAACAT
GTAACAGTGACCACTGCAAGTGTAGCAGGTTCAGATGTTGGCGATATGGCCTTCGTTGTCAATCTTCCTAGTAAA
GAGGAAATCACTGTCGATGAGACTCCACTCGACGACGTCTTCACAGTGAGGCCGCGCCTTGTCAACGTTGAACCC
ATACCGCTCCCGGCTCCTTCCAACACCAAATCCACCAAATCGAGTTCTCCTGCCGACAAGCCTACCCAGTCCTCC
GAGCCATCTACCTCAGCTACAAGCCGAGATGCAGCCATTAGAACACAGCTCGAGCAACTCTCCCTCGAACCCGCT
TCGACGGACCCCACTCATTGGGCCCAAACGGAAGAGGCTGTGCTTCGTAAACCGGCAGGTGGAGATCCCGCAGGA
GAGGCGACAGAGGCTCCCTCTTCCGAAGGTGCTCCCCGACGTCCTTCTCTTCCTCCTATCCAAACTGTCTATAGC
CCCCCTCCCGCGCAACCTTCCCCCGCCTACCCATCCACCTACAGTTATCCCACACTACCGCCCGGGATTGCGCTT
AATCTCCATGGTGTTCCCTATGAAGTGGCGACTGGTCGTCCTGTGTATATACCTCCACCTGTCTACAACTCGCGG
CCTATCATGCACTCACACATGCCGCAACAGAGTATATCTTACATGTCGACGCCACATATGCATCCTTCTCCTGCC
ATCGCCTCTGATTTCGCTCATCACCCACCTTCACATCCCCATACTCCTTCAGGTCCTGCCAATGGCTTCCTTGAT
CCGGCGACCGGTGCTCCGGTGTTCTCTTTCCCTAGGGCAGCACGTGTGGAGATACGTGCACCAGGAGACGATGGT
AGCGAATCCCTTCAGAACGGCAACGTCAAGTCGTCGTCAGTGACGTCCCCTCTTGCTCACAATTCATCTCACCTA
CACGTACCCTCTGTCCCGTACAGCAACTCTCCATCTCACTCAGGAGTTGAGTATGGCTATCATTCATATGGTTCA
TCTTCAGATGCCGGCACACTACCTTCATACGCACCATTACCAGATGCGAATGCCCCATCGGACGCAACATCTAAT
GCACCACCACCACAAGCAATGATGCAGTATCCAGCGTATCAACAATACTATTATCCAGAAGCCCCATATGGATAT
ACGCAATATGTGGGCGTGTCGCAAACCGGGCAGTATGAAATGTATGTGCCTATGGAGGTACATGGCACAACCTAT
TATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail