Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067550
Gene name
Locationscaffold_04:726724..727288
Strand-
Gene length (bp)564
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 4.6E-11 15 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0MQE8|NDUB9_PONAB NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Pongo abelii GN=NDUFB9 PE=2 SV=3 10 92 1.0E-13
sp|Q9Y6M9|NDUB9_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens GN=NDUFB9 PE=1 SV=3 10 92 2.0E-13
sp|Q0MQE9|NDUB9_GORGO NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Gorilla gorilla gorilla GN=NDUFB9 PE=2 SV=3 10 92 2.0E-13
sp|Q0MQF0|NDUB9_PANTR NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Pan troglodytes GN=NDUFB9 PE=2 SV=3 10 92 2.0E-13
sp|Q945M1|NDUB9_ARATH NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Arabidopsis thaliana GN=CIB22 PE=1 SV=1 2 96 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0MQE8|NDUB9_PONAB NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Pongo abelii GN=NDUFB9 PE=2 SV=3 10 92 1.0E-13
sp|Q9Y6M9|NDUB9_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens GN=NDUFB9 PE=1 SV=3 10 92 2.0E-13
sp|Q0MQE9|NDUB9_GORGO NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Gorilla gorilla gorilla GN=NDUFB9 PE=2 SV=3 10 92 2.0E-13
sp|Q0MQF0|NDUB9_PANTR NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Pan troglodytes GN=NDUFB9 PE=2 SV=3 10 92 2.0E-13
sp|Q945M1|NDUB9_ARATH NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Arabidopsis thaliana GN=CIB22 PE=1 SV=1 2 96 2.0E-13
sp|Q9CQJ8|NDUB9_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Mus musculus GN=Ndufb9 PE=1 SV=3 10 92 1.0E-12
sp|Q02369|NDUB9_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Bos taurus GN=NDUFB9 PE=1 SV=2 10 92 4.0E-12
sp|Q54NR3|NDUB9_DICDI NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Dictyostelium discoideum GN=ndufb9 PE=3 SV=1 10 96 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067550
MSANTAFSSAHRIYVKSLYKRYLTNSLDWCINRPLWREQAMLIRAEFEKNRDVTDPRALAEILERAERDLVARRH
PDPYIAPSFPGGTKWERNTPPDVRPPYDHEANADHH*
Coding >Agabi119p4|067550
ATGTCTGCCAACACCGCTTTCTCTTCAGCTCACAGAATCTATGTTAAATCACTCTACAAGCGATACCTCACAAAT
TCGCTTGACTGGTGTATCAACAGGCCCTTATGGCGAGAGCAGGCGATGCTGATTCGGGCGGAATTCGAGAAGAAC
CGTGATGTGACTGACCCTCGTGCGTTGGCTGAAATTTTGGAAAGAGCAGAAAGGGATTTGGTCGCAAGGCGGCAT
CCTGACCCATACATCGCTCCTTCCTTCCCTGGTGGCACAAAATGGGAACGCAATACTCCCCCCGATGTACGGCCT
CCCTATGATCACGAAGCAAACGCAGACCACCATTAG
Transcript >Agabi119p4|067550
ATGTCTGCCAACACCGCTTTCTCTTCAGCTCACAGAATCTATGTTAAATCACTCTACAAGCGATACCTCACAAAT
TCGCTTGACTGGTGTATCAACAGGCCCTTATGGCGAGAGCAGGCGATGCTGATTCGGGCGGAATTCGAGAAGAAC
CGTGATGTGACTGACCCTCGTGCGTTGGCTGAAATTTTGGAAAGAGCAGAAAGGGATTTGGTCGCAAGGCGGCAT
CCTGACCCATACATCGCTCCTTCCTTCCCTGGTGGCACAAAATGGGAACGCAATACTCCCCCCGATGTACGGCCT
CCCTATGATCACGAAGCAAACGCAGACCACCATTAG
Gene >Agabi119p4|067550
ATGTCTGCCAACACCGCTTTCTCTTCAGCTCACAGAATCTATGTTAAATCACTCTACAAGCGATACCTCACAAAT
TCGCTTGACTGGTGTATCAACAGGCCCTTATGGCGAGAGCAGGCGATGCTGATTCGGGCGGAATTCGAGAAGAAC
CGGTACTGTCGCGACTTTGAACCCCCTCTGTCCGGACGATACTTATGATGCATATATGCAGTGATGTGACTGACC
CTCGTGCGTTGGCTGAAATTTTGGAAAGAGCAGAAAGGGATTTGGTCGCAAGGCGGCATCCTGACCCATACATCG
GTCAGTTCAACACTCCGTCTCCCAGATACACTCCTCTCATACCTACCCACAGCTCCTTCCTTCCCTGGTGGCACA
AAATGGTGTGTATCCATCTACCCAAAGTTCAATCAAGTATATGCTAACCTATTTGGCCAGGGAACGCAATACTCC
CGTACGTGTTACCCTGTCTTCCTCAGCGGTGTCCATGTATTCACGCGGGCTTTCTTTCATTAGCCCGATGTACGG
CCTCCCTATGATCACGAAGCAAACGCAGACCACCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail