Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067530
Gene name
Locationscaffold_04:719343..723497
Strand-
Gene length (bp)4154
Transcript length (bp)3375
Coding sequence length (bp)3375
Protein length (aa) 1125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08235 LNS2 LNS2 (Lipin/Ned1/Smp2) 8.0E-100 693 918
PF04571 Lipin_N lipin, N-terminal conserved region 1.3E-34 1 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ6|NED1_SCHPO Nuclear elongation and deformation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ned1 PE=1 SV=1 644 938 5.0E-106
sp|P32567|PAH1_YEAST Phosphatidic acid phosphohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAH1 PE=1 SV=1 689 943 2.0E-94
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 691 939 2.0E-74
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 691 939 8.0E-74
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 691 939 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ6|NED1_SCHPO Nuclear elongation and deformation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ned1 PE=1 SV=1 644 938 5.0E-106
sp|P32567|PAH1_YEAST Phosphatidic acid phosphohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAH1 PE=1 SV=1 689 943 2.0E-94
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 691 939 2.0E-74
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 691 939 8.0E-74
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 691 939 1.0E-73
sp|Q92539|LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens GN=LPIN2 PE=1 SV=1 691 947 9.0E-70
sp|Q99PI5|LPIN2_MOUSE Phosphatidate phosphatase LPIN2 OS=Mus musculus GN=Lpin2 PE=1 SV=2 691 939 7.0E-69
sp|Q9SF47|PAH1_ARATH Phosphatidate phosphatase PAH1 OS=Arabidopsis thaliana GN=PAH1 PE=1 SV=1 660 938 6.0E-65
sp|Q14693|LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens GN=LPIN1 PE=1 SV=2 668 946 3.0E-64
sp|Q91ZP3|LPIN1_MOUSE Phosphatidate phosphatase LPIN1 OS=Mus musculus GN=Lpin1 PE=1 SV=1 691 946 3.0E-63
sp|Q9FMN2|PAH2_ARATH Phosphatidate phosphatase PAH2 OS=Arabidopsis thaliana GN=PAH2 PE=1 SV=1 666 939 9.0E-62
sp|Q9UUJ6|NED1_SCHPO Nuclear elongation and deformation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ned1 PE=1 SV=1 1 267 4.0E-27
sp|P32567|PAH1_YEAST Phosphatidic acid phosphohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAH1 PE=1 SV=1 1 115 9.0E-22
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 1 111 2.0E-20
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 1 111 2.0E-20
sp|Q14693|LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens GN=LPIN1 PE=1 SV=2 1 112 2.0E-20
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 1 111 3.0E-20
sp|Q91ZP3|LPIN1_MOUSE Phosphatidate phosphatase LPIN1 OS=Mus musculus GN=Lpin1 PE=1 SV=1 1 112 3.0E-20
sp|Q92539|LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens GN=LPIN2 PE=1 SV=1 1 144 1.0E-17
sp|Q99PI5|LPIN2_MOUSE Phosphatidate phosphatase LPIN2 OS=Mus musculus GN=Lpin2 PE=1 SV=2 1 130 2.0E-15
sp|Q9SF47|PAH1_ARATH Phosphatidate phosphatase PAH1 OS=Arabidopsis thaliana GN=PAH1 PE=1 SV=1 18 99 9.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067530
MNYLRGAVNAISAPYQYYKELPPINPSTLTGAIDVIVIQGPGAAGDTELACSPFHVRFGKWQVLRPSDKKVTISV
NGQPIPYYMKIGDAGEAFFVFETDEEVPPDLITSPIIQPTMPEEDASDAQLDAPVGHLGNIDHPPSDASASEEAP
KPLPEVELEQEVHDDSQEPEFLDLNASSSNIRLPKQVEGSPHDANVTPAQRFHQPSFLRHSASQSTLQRHPSPKK
TFRRTDEIVKDLESNIRAPEVEYHHDVALDSQGYNTHARELSDQTVHPSSPAKFQFPSLKTPPRISAALREAQTA
IHSTNSSDAEPDFEDEPYPSSKHRRLRATSEPPPELDDHLRPPTDSEFLFDSDQDTPTISEPKFTHGLKIDFHPP
TSPSRIQEYSWEWGAFPTPSPVRTIFGKGGRFESRKNKENEDEDVLAGAYVTISAKNEEDTTLLLTINRRTLDFQ
LSLVPGPESYFNGDRSEEGVIELSQSPSGDEFARRFEEGKITFSEFMRDDSIYRNPALVVKWVDGHFVSLYDNPL
LFEALASWRTNTLNSRSRKGENETLVDTTRHSKSKSEPPTPEQKAAAEAEDLGNGTDKKPGSLSWVQWWSRNRQR
NTVDVAPVVLAERPVLRPAATEPLPGTAKAQTFMLDKASLKKLSQQRVLEDPEADSAFPSTPSDLTLNEEAAPQA
SPTPAAEQQPQPSRKFVKTLRLTSDQLKALDLKPGANMITFSISSGVIACTSRIFVWDYMDHVVVSDIDGTITKS
DGLGHVFAMIGRDWTHVGVAKLYTDIVKNGYKIMYLTSRAIGQADATRGYLKGIKQDDYQLPEGPVIMSPDRLIA
SLHREVIMRKPEVFKMACLRDIQRLFGEHSKNPFYAGFGNRITDALSYRSVNVPSARIFTIDSTGVVKMELLELA
GYESSYIHMTDLVDQMFPPINKKWAPEYTDLTYWKAPVPDYPPPDLAPPSPTLSALSETSNQSTLAKIRNFRLIG
GSRANSLSSPPNELANNVNSSQGGNNAGLSNDPEHENELRQMSSFERLVNGLRRSVSPSSTSSHAADSDSESDDD
VPRDGRRPRRRSMSSMPGSLDDMQFAFDDDQGEDEEDEDEDDKESEGEYEHEEGEMDEDLTMDEDLKEAVAEKY*
Coding >Agabi119p4|067530
ATGAACTACCTTCGAGGCGCGGTGAATGCAATCAGCGCACCCTACCAATACTACAAAGAATTACCGCCAATCAAC
CCATCTACTCTTACTGGTGCTATCGACGTTATTGTTATCCAAGGACCCGGCGCTGCTGGAGATACAGAACTAGCG
TGTTCGCCGTTTCATGTTCGGTTTGGCAAGTGGCAGGTGTTGAGACCAAGTGACAAGAAGGTGACCATATCTGTC
AATGGCCAGCCTATACCCTATTACATGAAGATCGGAGACGCGGGCGAGGCCTTCTTTGTCTTCGAAACAGATGAA
GAGGTTCCTCCAGATCTTATCACCTCACCCATTATCCAGCCCACGATGCCTGAAGAAGATGCCTCTGATGCTCAG
CTAGACGCTCCGGTGGGTCATTTGGGGAACATAGATCACCCTCCTAGTGATGCAAGTGCATCCGAGGAAGCTCCG
AAACCTCTTCCGGAAGTGGAATTAGAGCAGGAGGTACACGACGACTCTCAAGAACCAGAATTCTTGGATCTAAAC
GCTAGTAGCAGTAACATCCGGCTTCCCAAACAAGTAGAGGGATCTCCTCATGATGCCAACGTTACACCGGCACAA
CGATTCCACCAACCCTCCTTCCTTCGACATTCCGCTTCTCAGAGCACCCTTCAACGACACCCGTCACCAAAGAAG
ACATTTAGGAGAACAGATGAAATTGTCAAAGATCTCGAATCAAATATTAGGGCACCTGAAGTGGAGTACCATCAC
GATGTGGCATTAGACTCGCAGGGTTACAATACACATGCAAGGGAATTGTCTGATCAGACAGTTCATCCATCAAGC
CCAGCAAAGTTCCAATTCCCTTCGCTTAAGACTCCTCCGCGAATTTCAGCCGCTCTGAGAGAAGCCCAGACCGCA
ATTCATTCTACCAATAGCTCTGACGCCGAACCTGATTTCGAAGACGAGCCATATCCATCCTCAAAGCACCGCAGA
TTACGTGCCACCTCCGAGCCACCTCCTGAACTCGACGACCACTTACGACCACCGACAGACTCAGAGTTTTTATTT
GACAGCGACCAGGATACACCAACAATCTCGGAGCCCAAATTCACTCATGGGTTGAAGATCGATTTTCACCCGCCC
ACATCTCCATCAAGAATACAGGAATACTCTTGGGAATGGGGAGCATTTCCGACTCCTTCTCCCGTGAGGACGATA
TTCGGGAAAGGTGGGAGGTTCGAAAGTCGGAAGAATAAGGAGAACGAAGACGAAGACGTGCTGGCCGGTGCATAT
GTAACAATTTCGGCCAAGAACGAGGAGGATACTACCCTTCTTTTGACCATCAACCGTAGAACATTAGACTTCCAG
TTAAGCCTGGTTCCGGGACCAGAATCATACTTCAATGGGGATCGGAGCGAGGAAGGCGTCATTGAATTGTCACAA
AGTCCCAGTGGCGATGAATTCGCTCGGCGATTCGAAGAAGGAAAAATTACTTTCTCTGAGTTCATGCGGGACGAT
AGCATTTACAGAAACCCGGCGCTCGTGGTAAAATGGGTGGATGGTCATTTTGTTTCCTTATATGATAATCCTCTA
TTGTTTGAAGCGTTGGCGTCATGGCGGACGAACACATTGAATAGTAGATCAAGGAAAGGAGAGAATGAAACTCTG
GTTGATACAACACGTCACTCGAAATCGAAATCCGAGCCTCCAACACCGGAACAAAAGGCGGCTGCAGAGGCTGAG
GATTTAGGGAATGGGACGGACAAGAAACCTGGTTCTTTGTCCTGGGTTCAATGGTGGAGTCGGAACAGGCAACGC
AACACAGTGGACGTTGCACCTGTAGTCCTTGCGGAACGGCCAGTTCTGAGACCTGCCGCTACGGAGCCCTTACCT
GGAACAGCGAAGGCTCAGACATTCATGTTGGACAAGGCATCACTTAAGAAATTGTCTCAGCAGAGGGTTTTGGAA
GATCCGGAAGCTGATTCTGCGTTCCCTTCTACACCGAGTGATCTCACGTTGAACGAAGAGGCTGCACCACAAGCC
AGTCCAACGCCTGCTGCTGAACAGCAGCCGCAGCCTTCAAGAAAATTTGTGAAGACTCTAAGGTTGACGTCAGAT
CAGCTCAAAGCGCTAGATCTCAAGCCTGGAGCAAATATGATAACGTTTTCAATATCTTCCGGTGTAATTGCATGT
ACTTCCCGCATATTCGTCTGGGACTACATGGACCACGTCGTCGTTTCAGACATTGATGGTACAATAACCAAATCG
GATGGTCTAGGACATGTATTCGCCATGATCGGGCGCGATTGGACACACGTTGGTGTAGCAAAACTATACACCGAT
ATTGTCAAAAATGGGTACAAGATCATGTATCTCACTTCTCGTGCTATTGGACAGGCGGACGCGACAAGAGGTTAT
TTGAAGGGCATTAAGCAGGACGACTATCAGCTTCCCGAAGGGCCTGTAATCATGAGTCCCGACCGACTTATAGCT
TCACTGCATAGGGAGGTGATTATGCGTAAACCAGAGGTTTTCAAGATGGCATGTTTGCGTGATATACAAAGACTT
TTTGGCGAGCACTCGAAGAATCCTTTTTATGCTGGTTTCGGGAATAGGATTACGGATGCATTGTCCTACCGGAGT
GTCAATGTTCCGAGCGCAAGAATCTTCACGATCGATTCGACGGGTGTAGTGAAGATGGAGTTATTGGAGTTGGCT
GGATACGAATCATCATACATCCACATGACCGACCTTGTTGATCAAATGTTCCCTCCGATTAATAAGAAATGGGCA
CCCGAATACACGGATCTCACTTACTGGAAAGCACCCGTACCAGACTACCCACCTCCCGACTTAGCGCCACCCTCG
CCAACACTCAGTGCCCTTTCGGAAACCTCAAACCAGAGTACACTTGCCAAAATACGGAATTTCAGGCTCATTGGT
GGCTCTCGTGCCAACAGCCTCAGTAGTCCTCCGAATGAACTCGCTAACAATGTCAACTCTTCTCAGGGCGGTAAT
AATGCTGGCCTGAGTAATGACCCGGAACACGAAAACGAGTTACGGCAAATGTCCTCTTTCGAAAGGCTAGTCAAT
GGGTTGAGACGTAGCGTGAGCCCATCGTCTACCTCGTCACATGCAGCGGATTCGGATTCCGAAAGTGATGACGAT
GTACCTCGGGATGGACGGAGGCCCAGGAGAAGGAGCATGAGCAGTATGCCTGGGAGCTTAGATGATATGCAATTC
GCATTTGATGATGATCAAGGAGAGGATGAGGAGGATGAAGACGAAGACGATAAGGAAAGTGAAGGAGAATATGAA
CATGAGGAAGGAGAGATGGATGAGGATCTGACAATGGATGAAGATTTAAAAGAGGCCGTGGCTGAGAAGTATTAA
Transcript >Agabi119p4|067530
ATGAACTACCTTCGAGGCGCGGTGAATGCAATCAGCGCACCCTACCAATACTACAAAGAATTACCGCCAATCAAC
CCATCTACTCTTACTGGTGCTATCGACGTTATTGTTATCCAAGGACCCGGCGCTGCTGGAGATACAGAACTAGCG
TGTTCGCCGTTTCATGTTCGGTTTGGCAAGTGGCAGGTGTTGAGACCAAGTGACAAGAAGGTGACCATATCTGTC
AATGGCCAGCCTATACCCTATTACATGAAGATCGGAGACGCGGGCGAGGCCTTCTTTGTCTTCGAAACAGATGAA
GAGGTTCCTCCAGATCTTATCACCTCACCCATTATCCAGCCCACGATGCCTGAAGAAGATGCCTCTGATGCTCAG
CTAGACGCTCCGGTGGGTCATTTGGGGAACATAGATCACCCTCCTAGTGATGCAAGTGCATCCGAGGAAGCTCCG
AAACCTCTTCCGGAAGTGGAATTAGAGCAGGAGGTACACGACGACTCTCAAGAACCAGAATTCTTGGATCTAAAC
GCTAGTAGCAGTAACATCCGGCTTCCCAAACAAGTAGAGGGATCTCCTCATGATGCCAACGTTACACCGGCACAA
CGATTCCACCAACCCTCCTTCCTTCGACATTCCGCTTCTCAGAGCACCCTTCAACGACACCCGTCACCAAAGAAG
ACATTTAGGAGAACAGATGAAATTGTCAAAGATCTCGAATCAAATATTAGGGCACCTGAAGTGGAGTACCATCAC
GATGTGGCATTAGACTCGCAGGGTTACAATACACATGCAAGGGAATTGTCTGATCAGACAGTTCATCCATCAAGC
CCAGCAAAGTTCCAATTCCCTTCGCTTAAGACTCCTCCGCGAATTTCAGCCGCTCTGAGAGAAGCCCAGACCGCA
ATTCATTCTACCAATAGCTCTGACGCCGAACCTGATTTCGAAGACGAGCCATATCCATCCTCAAAGCACCGCAGA
TTACGTGCCACCTCCGAGCCACCTCCTGAACTCGACGACCACTTACGACCACCGACAGACTCAGAGTTTTTATTT
GACAGCGACCAGGATACACCAACAATCTCGGAGCCCAAATTCACTCATGGGTTGAAGATCGATTTTCACCCGCCC
ACATCTCCATCAAGAATACAGGAATACTCTTGGGAATGGGGAGCATTTCCGACTCCTTCTCCCGTGAGGACGATA
TTCGGGAAAGGTGGGAGGTTCGAAAGTCGGAAGAATAAGGAGAACGAAGACGAAGACGTGCTGGCCGGTGCATAT
GTAACAATTTCGGCCAAGAACGAGGAGGATACTACCCTTCTTTTGACCATCAACCGTAGAACATTAGACTTCCAG
TTAAGCCTGGTTCCGGGACCAGAATCATACTTCAATGGGGATCGGAGCGAGGAAGGCGTCATTGAATTGTCACAA
AGTCCCAGTGGCGATGAATTCGCTCGGCGATTCGAAGAAGGAAAAATTACTTTCTCTGAGTTCATGCGGGACGAT
AGCATTTACAGAAACCCGGCGCTCGTGGTAAAATGGGTGGATGGTCATTTTGTTTCCTTATATGATAATCCTCTA
TTGTTTGAAGCGTTGGCGTCATGGCGGACGAACACATTGAATAGTAGATCAAGGAAAGGAGAGAATGAAACTCTG
GTTGATACAACACGTCACTCGAAATCGAAATCCGAGCCTCCAACACCGGAACAAAAGGCGGCTGCAGAGGCTGAG
GATTTAGGGAATGGGACGGACAAGAAACCTGGTTCTTTGTCCTGGGTTCAATGGTGGAGTCGGAACAGGCAACGC
AACACAGTGGACGTTGCACCTGTAGTCCTTGCGGAACGGCCAGTTCTGAGACCTGCCGCTACGGAGCCCTTACCT
GGAACAGCGAAGGCTCAGACATTCATGTTGGACAAGGCATCACTTAAGAAATTGTCTCAGCAGAGGGTTTTGGAA
GATCCGGAAGCTGATTCTGCGTTCCCTTCTACACCGAGTGATCTCACGTTGAACGAAGAGGCTGCACCACAAGCC
AGTCCAACGCCTGCTGCTGAACAGCAGCCGCAGCCTTCAAGAAAATTTGTGAAGACTCTAAGGTTGACGTCAGAT
CAGCTCAAAGCGCTAGATCTCAAGCCTGGAGCAAATATGATAACGTTTTCAATATCTTCCGGTGTAATTGCATGT
ACTTCCCGCATATTCGTCTGGGACTACATGGACCACGTCGTCGTTTCAGACATTGATGGTACAATAACCAAATCG
GATGGTCTAGGACATGTATTCGCCATGATCGGGCGCGATTGGACACACGTTGGTGTAGCAAAACTATACACCGAT
ATTGTCAAAAATGGGTACAAGATCATGTATCTCACTTCTCGTGCTATTGGACAGGCGGACGCGACAAGAGGTTAT
TTGAAGGGCATTAAGCAGGACGACTATCAGCTTCCCGAAGGGCCTGTAATCATGAGTCCCGACCGACTTATAGCT
TCACTGCATAGGGAGGTGATTATGCGTAAACCAGAGGTTTTCAAGATGGCATGTTTGCGTGATATACAAAGACTT
TTTGGCGAGCACTCGAAGAATCCTTTTTATGCTGGTTTCGGGAATAGGATTACGGATGCATTGTCCTACCGGAGT
GTCAATGTTCCGAGCGCAAGAATCTTCACGATCGATTCGACGGGTGTAGTGAAGATGGAGTTATTGGAGTTGGCT
GGATACGAATCATCATACATCCACATGACCGACCTTGTTGATCAAATGTTCCCTCCGATTAATAAGAAATGGGCA
CCCGAATACACGGATCTCACTTACTGGAAAGCACCCGTACCAGACTACCCACCTCCCGACTTAGCGCCACCCTCG
CCAACACTCAGTGCCCTTTCGGAAACCTCAAACCAGAGTACACTTGCCAAAATACGGAATTTCAGGCTCATTGGT
GGCTCTCGTGCCAACAGCCTCAGTAGTCCTCCGAATGAACTCGCTAACAATGTCAACTCTTCTCAGGGCGGTAAT
AATGCTGGCCTGAGTAATGACCCGGAACACGAAAACGAGTTACGGCAAATGTCCTCTTTCGAAAGGCTAGTCAAT
GGGTTGAGACGTAGCGTGAGCCCATCGTCTACCTCGTCACATGCAGCGGATTCGGATTCCGAAAGTGATGACGAT
GTACCTCGGGATGGACGGAGGCCCAGGAGAAGGAGCATGAGCAGTATGCCTGGGAGCTTAGATGATATGCAATTC
GCATTTGATGATGATCAAGGAGAGGATGAGGAGGATGAAGACGAAGACGATAAGGAAAGTGAAGGAGAATATGAA
CATGAGGAAGGAGAGATGGATGAGGATCTGACAATGGATGAAGATTTAAAAGAGGCCGTGGCTGAGAAGTATTAA
Gene >Agabi119p4|067530
ATGAACTACCTTCGAGGCGCGGTGAATGCAATCAGCGCACCCTACCAATACTACAAAGAATTACCGCCAATCAAC
CCATCTACTCTTACTGGTGCTATCGACGTTATTGTTATCCAAGGACCCGGCGCTGCTGGAGATACAGAACTAGCG
TGTTCGCCGTTTCATGTTCGGTTTGGCAAGTGGCAGGTGTTGAGACCAAGTGACAAGAAGGTGAGCAAGCTTTCC
CGCATTCCCTCCTGATTATATGTTGACCATGTATGCCTACAAGGTGACCATATCTGTCAATGGCCAGCCTATACC
CTATTACATGAAGATCGGAGACGCGGGCGAGGCCTTCTTTGTCTTCGAAACAGATGAAGAGGTTCCTCCAGATCT
TATCACCTCACCCATTATCCAGCCCACGATGCCTGAAGAAGATGCCTCTGATGCTCAGCTAGACGCTCCGGTGGG
TCATTTGGGGAACATAGATCACCCTCCTAGTGATGCAAGTGCATCCGAGGAAGCTCCGAAACCTCTTCCGGAAGT
GGAATTAGAGCAGGAGGTACACGACGACTCTCAAGAACCAGAATTCTTGGATCTAAACGCTAGTAGCAGTAACAT
CCGGCTTCCCAAACAAGTAGAGGGATCTCCTCATGATGCCAACGTTACACCGGCACAACGATTCCACCAACCCTC
CTTCCTTCGACATTCCGCTTCTCAGAGCACCCTTCAACGACAGTCAGTCATCTATTAACTTGACTCTTGATTCTC
TTACCCATTCACCCTGTAGCCCGTCACCAAAGAAGACATTTAGGAGAACAGATGAAATTGTCAAAGATCTCGAAT
CAAATATTAGGGCACCTGAAGTGGAGTACCATCACGGTAAGCGTTTCTTTGGCACCATTCGTTCCCCAAATCACT
CAATTTTGTCTTAGATGTGGCATTAGACTCGCAGGGTTACAATACACATGCAAGGGAATTGTCTGATCAGACAGT
TCATCCATCAAGCCCAGCAAAGTTCCAATTCCCTTCGCTTAAGAGTATGATACTATCCGTTCCTGTATTCGACGA
TGCTAACATGGTTTCGTGATGACAGCTCCTCCGCGAATTTCAGCCGCTCTGAGAGAAGCCCAGACCGCAATTCAT
TCTACCAATAGCTCTGACGCCGAACCTGATTTCGAAGACGAGCCATATCCATCCTCAAAGCACCGCAGATTACGT
GCCACCTCCGAGCCACCTCCTGAACTCGACGACCACTTACGACCACCGACAGACTCAGAGTTTTTATTTGACAGC
GACCAGGATACACCAACAATCTCGGAGCCCAAATTCACTCATGGGTTGAAGATCGATTTTCACCCGCCCACATCT
CCATCAAGAATACAGGAATACTCTTGGGAATGGGGAGCATTTCCGACTCCTTCTCCCGTGAGGACGATATTCGGG
AAAGGTGGGAGGTTCGAAAGTCGGAAGAATAAGGAGAACGAAGACGAAGACGTGCTGGCCGGTGCATATGTAACA
ATTTCGGCCAAGAACGAGGAGGATACTACCCTTCTTTTGACCATCAACCGTAGAACATTAGACTTCCAGTTAAGC
CTGGTTCCGGGACCAGAATCATACTTCAATGGGGATCGGAGCGAGGAAGGCGTCATTGAATTGTCACAAAGTCCC
AGTGGCGATGAATTCGCTCGGCGATTCGAAGAAGGAAAAATTACTTTCTCTGAGTTCATGCGGGACGATAGCATT
TACAGAAACCCGGCGCTCGTGGTAAAATGGGTGGATGGTCATTTTGTTTCCTTATATGATAATCCTCTATTGTTT
GAAGCGTTGGCGTCATGGCGGACGAACACATTGAATAGTAGATCAAGGAAAGGAGAGAATGAAACTCTGGTTGAT
ACAACACGTCACTCGAAATCGAAATCCGAGCCTCCAACACCGGAACAAAAGGCGGCTGCAGAGGCTGAGGATTTA
GGGAATGGGACGGACAAGAAACCTGGTTCTTTGTCCTGGGTTCAATGGTGGAGTCGGAACAGGCAACGCAACACA
GTGGACGTTGCACCTGTAGTCCTTGCGGAACGGCCAGTTCTGAGACCTGCCGCTACGGAGCCCTTACCTGTGCGT
ATTTTCTTCATCTGTTTTCCGATTTAGCGCTGATCTTCTGATGTATAGGGAACAGCGAAGGCTCAGACATTCATG
TTGGACAAGGCATCACTTAAGAAATTGTCTCAGCAGAGGGTTTTGGAAGATCCGGAAGCTGATTCTGCGTTCCCT
TCTACACCGAGTGATCTCACGTTGAACGAAGAGGCTGCACCACAAGCCAGTCCAACGCCTGCTGCTGAACAGCAG
CCGCAGCCTTCAAGAAAATTTGTGAAGACTCTAAGGTTGACGTCAGATCAGCTCGTACGTGCTTTCTGTATATCT
ATCACTTGAAACCTACTGAAAGCATCTCTAGAAAGCGCTAGATCTCAAGCCTGGAGCAAATATGATAACGTTTTC
AATATCTTCCGGTGTAATTGCATGTACTTCCCGCATATTCGTCTGGGACTACATGGACCACGTCGTCGTTTCAGA
CATTGATGGTACAATAACCAAGTAAGCTTTCTTACCGCTCCTGATCGGATCGGATCTATGTACTAACACCCCTGT
AGATCGGATGGTCTAGGACATGTATTCGCCATGATCGGGCGCGATTGGACACACGTTGGTGTAGCAAAACTATAC
ACCGATATTGTCAAAAATGGGTACAAGATCATGTATCTCACTTCTCGTGCTATTGGACAGGCGGACGCGACAAGA
GGTTATTTGAAGGGCATTAAGCAGGACGACTATCAGCTTCCCGAAGGGCCTGTAATCATGAGTCCCGACCGACTT
ATAGCTTCACTGCATAGGTGCGTACACCTCCTTACTATCTAAGTAGCAACTAATCGATAGAGTGCAGGGAGGTGA
TTATGCGTAAACCAGAGGTTTTCAAGATGGCATGTTTGCGTGATATACAAAGACTTTTTGGCGAGCACTCGAAGA
ATCCTTTTTATGCTGGTTTCGGGAATAGGATTACGGATGCATTGTCCTACCGGAGTGTCAATGTTCCGAGCGCAA
GAATCTTCACGATCGATTCGACGGGTGTAGTGAAGATGGAGTTATTGGAGTTGGCTGGATACGAATCATCGTACG
TCTATCCGTTCCCTTTGAGTATCTGCTGTTAAACCTGCCCAAGATACATCCACATGACCGACCTTGTTGATCAAA
TGTTCCCTCCGATTAATAAGAAATGGGCACCCGAATACACGGATCTCACTTACTGGAAAGCACCCGTACCAGACT
ACCCACCTCCCGACTTAGCGCCACCCTCGCCAACACTCAGTGCCCTTTCGGAAACCTCAAACCAGAGTACACTTG
CCAAAATACGGAATTTCAGGCTCATTGGTGGCTCTCGTGCCAACAGCCTCAGTAGTCCTCCGAATGAACTCGCTA
ACAATGTCAACTCTTCTCAGGGCGGTAATAATGCTGGCCTGAGTAATGACCCGGAACACGAAAACGAGTTACGGC
AAATGTCCTCTTTCGAAAGGCTAGTCAATGGGTTGAGACGTAGCGTGAGCCCATCGTCTACCTCGTCACATGCAG
CGGATTCGGATTCCGAAAGTGATGACGATGTACCTCGGGATGGACGGAGGCCCAGGAGAAGGAGCATGAGCAGTA
TGCCTGGGAGCTTAGATGATATGCAATTCGCATTTGATGATGATCAAGGAGAGGATGAGGAGGATGAAGACGAAG
ACGATAAGGAAAGTGAAGGAGAATATGAACATGAGGAAGGAGAGATGGATGAGGATCTGACAATGGATGAAGATT
TGTTGGCTGCGACAGAGATGAAGAAGATACCTTTCTTATGACCGCCTGGGCAGCTCCATCCCAGGGTGATAAACA
GTTTGCTTTGGTCGATTATGAGCCTAAGGATACCACGATAATACGGTTATATGAACTCATCCGCATGTAACATTC
GTGCAACGGCGCAGCAGCTATTCCCACTCCGCTCTTGCTGGTAGAATCGTTCTCAGGGTATCATAGGTGCCCTTT
GCGAATTTCACTGTTGAAGAAAAGAGGCCGTGGCTGAGAAGTGTGCGTAAAGCGCTCATTCTTCTTGGAGGGGCA
TAGTATGACGATGCTACTCTAAAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail