Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067510
Gene name
Locationscaffold_04:714954..716693
Strand+
Gene length (bp)1739
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 1.0E-14 29 134
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 1.9E-13 194 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 30 336 7.0E-22
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 40 304 1.0E-15
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 40 304 2.0E-15
sp|O04274|LDOX_PERFR Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1 28 308 7.0E-14
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 31 304 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 30 336 7.0E-22
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 40 304 1.0E-15
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 40 304 2.0E-15
sp|O04274|LDOX_PERFR Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1 28 308 7.0E-14
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 31 304 2.0E-13
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 40 321 2.0E-13
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 1 293 5.0E-13
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 21 346 7.0E-13
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 162 312 8.0E-13
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 162 312 8.0E-13
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 31 326 9.0E-13
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 31 304 1.0E-12
sp|P51092|LDOX_PETHY Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1 23 308 2.0E-12
sp|P51091|LDOX_MALDO Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1 57 308 2.0E-12
sp|P12438|IPNS_STRMI Isopenicillin N synthase OS=Streptomyces microflavus GN=pcbC PE=3 SV=1 26 305 3.0E-12
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 26 320 8.0E-12
sp|Q9C955|GAOX4_ARATH Gibberellin 20 oxidase 4 OS=Arabidopsis thaliana GN=GA20OX4 PE=2 SV=1 49 307 9.0E-12
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1 40 304 1.0E-11
sp|Q96323|LDOX_ARATH Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1 42 307 2.0E-11
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 40 326 2.0E-11
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 31 304 3.0E-11
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 30 324 3.0E-11
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Malus domestica PE=1 SV=1 26 304 4.0E-11
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 42 304 5.0E-11
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 31 304 5.0E-11
sp|Q40061|IDS2_HORVU Mugineic-acid 3-dioxygenase OS=Hordeum vulgare GN=IDS2 PE=2 SV=1 28 307 6.0E-11
sp|P05189|IPNS_ACRCH Isopenicillin N synthase OS=Acremonium chrysogenum GN=PCBC PE=1 SV=1 26 341 8.0E-11
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 40 304 9.0E-11
sp|P24157|ACCO4_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1 42 304 1.0E-10
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 42 304 1.0E-10
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1 40 304 1.0E-10
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 31 326 2.0E-10
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2 31 304 2.0E-10
sp|P18286|IPNS_STRJU Isopenicillin N synthase OS=Streptomyces jumonjinensis GN=pcbC PE=3 SV=1 26 304 3.0E-10
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 26 306 4.0E-10
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 41 305 5.0E-10
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 30 324 7.0E-10
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 158 293 9.0E-10
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1 2 274 1.0E-09
sp|Q39112|GAOX3_ARATH Gibberellin 20 oxidase 3 OS=Arabidopsis thaliana GN=GA20OX3 PE=2 SV=1 46 304 1.0E-09
sp|P05326|IPNS_EMENI Isopenicillin N synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipnA PE=1 SV=1 26 305 1.0E-09
sp|Q06588|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana GN=ACO4 PE=1 SV=2 40 307 2.0E-09
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 31 324 3.0E-09
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 42 326 4.0E-09
sp|Q39705|ACCO2_DORSP 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Doritaenopsis sp. GN=ACO2 PE=2 SV=1 42 304 4.0E-09
sp|P41213|LDOX_MAIZE Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 PE=2 SV=1 33 307 4.0E-09
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 28 293 5.0E-09
sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1 45 305 6.0E-09
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 187 294 9.0E-09
sp|Q9ZQZ1|ACCO_DENCR 1-aminocyclopropane-1-carboxylate oxidase OS=Dendrobium crumenatum GN=ACO PE=2 SV=1 163 307 9.0E-09
sp|Q9M547|FLS_EUSER Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=FLS PE=2 SV=1 27 307 9.0E-09
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 163 317 1.0E-08
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1 197 306 2.0E-08
sp|P51093|LDOX_VITVI Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1 57 302 3.0E-08
sp|Q9ZWQ9|FLS_CITUN Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1 191 307 3.0E-08
sp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase OS=Malus domestica GN=FLS PE=2 SV=1 45 304 3.0E-08
sp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1 30 307 5.0E-08
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 23 320 1.0E-07
sp|P27744|IPNS_AMYLA Isopenicillin N synthase OS=Amycolatopsis lactamdurans GN=pcbC PE=3 SV=1 47 305 1.0E-07
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 23 320 1.0E-07
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 15 307 2.0E-07
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA3OX1 PE=1 SV=2 195 313 2.0E-07
sp|O49561|G2OX8_ARATH Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis thaliana GN=GA2OX8 PE=1 SV=2 27 301 3.0E-07
sp|Q43383|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5 OS=Arabidopsis thaliana GN=2A6 PE=2 SV=2 41 275 3.0E-07
sp|Q40062|IDS3_HORVU 2'-deoxymugineic-acid 2'-dioxygenase OS=Hordeum vulgare GN=IDS3 PE=1 SV=3 28 307 7.0E-07
sp|Q06942|FL3H_MALDO Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1 13 312 8.0E-07
sp|Q9ZT84|G3OX2_ARATH Gibberellin 3-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA3OX2 PE=1 SV=2 195 307 8.0E-07
sp|Q7XZQ6|FLS_PETCR Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1 191 307 1.0E-06
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 46 325 1.0E-06
sp|Q9XHM5|G2OX2_PEA Gibberellin 2-beta-dioxygenase 2 OS=Pisum sativum GN=GA2OX2 PE=2 SV=1 42 307 1.0E-06
sp|Q39111|GAOX2_ARATH Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1 163 304 2.0E-06
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 43 314 2.0E-06
sp|D4N500|DIOX1_PAPSO Thebaine 6-O-demethylase OS=Papaver somniferum GN=T6ODM PE=1 SV=1 46 324 3.0E-06
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 27 307 3.0E-06
sp|Q41452|FLS_SOLTU Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1 27 305 3.0E-06
sp|D4N501|DIOX2_PAPSO Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum GN=DIOX2 PE=2 SV=1 48 324 3.0E-06
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 161 305 5.0E-06
sp|Q9ZTA1|AOP3C_ARATH 2-oxoglutarate-dependent dioxygenase AOP3 OS=Arabidopsis thaliana GN=AOP3 PE=2 SV=1 203 329 6.0E-06
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 28 307 7.0E-06
sp|P16020|IPNS_FLASS Isopenicillin N synthase OS=Flavobacterium sp. (strain SC 12,154) GN=pcbC PE=3 SV=1 26 295 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067510
MTIITQPPVVPHFVQAETTKENLDWADLDAVDLSKAKTHEGRKGLVKQVHDAMKNDGFLFVTNHSVTPQQMSRMF
DLSNYAVDNVSDEEKQNYVGNMRENGTYRGYKPRKFWHIAGGVRDQIEQYNMNFREIKDGTHPEPLRPFLSEIDA
FSDQIHSDIINTILRLIAMSLELDEDYFIQMHDRSANAETFLRFVKYFPHPEEEENKSGGVWLKGHTDFMTLTLL
FSQPVASLQIMTKDGQWKWVKHVENGVLVNIGEAIEFLTGGYYKPTIHRVRQPPLDQQNKTRVGLLYFCSAHDDV
VLRPIAESPVVQKGGDSESRLLDDKFPTAGEYGKARELMKKLWPVFYFGIIIKENCYYYYRILFS*
Coding >Agabi119p4|067510
ATGACTATCATAACCCAGCCTCCCGTGGTTCCCCACTTCGTGCAGGCTGAGACAACAAAGGAAAACTTGGACTGG
GCTGATCTCGACGCAGTCGATTTGTCCAAAGCCAAGACACACGAAGGCCGTAAGGGGCTGGTCAAGCAGGTCCAT
GATGCTATGAAGAACGATGGTTTTCTCTTTGTCACCAATCATAGTGTCACTCCCCAGCAGATGTCTAGAATGTTT
GATCTTTCTAACTACGCTGTTGATAATGTCAGCGACGAGGAGAAACAGAATTATGTTGGGAATATGAGAGAAAAC
GGAACCTATCGTGGATACAAGCCCCGCAAGTTCTGGCACATTGCTGGGGGTGTTCGCGATCAAATTGAACAATAC
AACATGAACTTCCGAGAAATTAAGGATGGAACCCATCCAGAACCTCTTAGGCCGTTCCTATCTGAAATCGACGCT
TTCTCGGATCAAATCCACTCTGATATAATTAACACAATTCTTCGTCTCATCGCAATGAGCTTGGAGCTAGATGAA
GATTACTTCATCCAGATGCATGATCGTTCTGCGAACGCAGAAACATTCCTCCGGTTTGTGAAATATTTCCCTCAT
CCAGAAGAAGAAGAGAATAAATCCGGCGGAGTCTGGTTGAAAGGACATACTGACTTTATGACGCTAACGTTGCTA
TTCAGCCAGCCAGTAGCATCCCTCCAGATAATGACTAAAGATGGGCAATGGAAGTGGGTCAAGCACGTTGAGAAT
GGAGTTCTTGTCAATATTGGAGAGGCAATTGAATTCCTGACAGGGGGCTACTACAAGCCGACAATCCATAGAGTG
CGCCAGCCACCTCTGGACCAACAAAACAAGACTAGAGTTGGACTCTTATATTTCTGTAGTGCTCATGACGATGTC
GTACTCAGGCCCATCGCAGAGAGCCCTGTCGTGCAGAAGGGAGGCGACTCTGAGTCTCGCTTGTTAGACGACAAA
TTTCCAACTGCGGGTGAATACGGAAAAGCCAGGGAATTGATGAAGAAGTTGTGGCCGGTGTTTTACTTCGGCATT
ATAATTAAAGAAAATTGCTACTACTACTACAGAATTTTATTCAGCTGA
Transcript >Agabi119p4|067510
ATGACTATCATAACCCAGCCTCCCGTGGTTCCCCACTTCGTGCAGGCTGAGACAACAAAGGAAAACTTGGACTGG
GCTGATCTCGACGCAGTCGATTTGTCCAAAGCCAAGACACACGAAGGCCGTAAGGGGCTGGTCAAGCAGGTCCAT
GATGCTATGAAGAACGATGGTTTTCTCTTTGTCACCAATCATAGTGTCACTCCCCAGCAGATGTCTAGAATGTTT
GATCTTTCTAACTACGCTGTTGATAATGTCAGCGACGAGGAGAAACAGAATTATGTTGGGAATATGAGAGAAAAC
GGAACCTATCGTGGATACAAGCCCCGCAAGTTCTGGCACATTGCTGGGGGTGTTCGCGATCAAATTGAACAATAC
AACATGAACTTCCGAGAAATTAAGGATGGAACCCATCCAGAACCTCTTAGGCCGTTCCTATCTGAAATCGACGCT
TTCTCGGATCAAATCCACTCTGATATAATTAACACAATTCTTCGTCTCATCGCAATGAGCTTGGAGCTAGATGAA
GATTACTTCATCCAGATGCATGATCGTTCTGCGAACGCAGAAACATTCCTCCGGTTTGTGAAATATTTCCCTCAT
CCAGAAGAAGAAGAGAATAAATCCGGCGGAGTCTGGTTGAAAGGACATACTGACTTTATGACGCTAACGTTGCTA
TTCAGCCAGCCAGTAGCATCCCTCCAGATAATGACTAAAGATGGGCAATGGAAGTGGGTCAAGCACGTTGAGAAT
GGAGTTCTTGTCAATATTGGAGAGGCAATTGAATTCCTGACAGGGGGCTACTACAAGCCGACAATCCATAGAGTG
CGCCAGCCACCTCTGGACCAACAAAACAAGACTAGAGTTGGACTCTTATATTTCTGTAGTGCTCATGACGATGTC
GTACTCAGGCCCATCGCAGAGAGCCCTGTCGTGCAGAAGGGAGGCGACTCTGAGTCTCGCTTGTTAGACGACAAA
TTTCCAACTGCGGGTGAATACGGAAAAGCCAGGGAATTGATGAAGAAGTTGTGGCCGGTGTTTTACTTCGGCATT
ATAATTAAAGAAAATTGCTACTACTACTACAGAATTTTATTCAGCTGA
Gene >Agabi119p4|067510
ATGACTATCATAACCCAGCCTCCCGTGGTTCCCCACTTCGTGCAGGCTGAGACAACAAAGGAAAACTGTATGCCC
AATATCATTCTCCTCGCTCTGACCTAACGCTAAGATCAATCTTCGATCAAGTGGACTGGGCTGATCTCGACGCAG
TCGATTTGTCCAAAGCCAAGACACACGAAGGCCGTAAGGGGCTGGTCAAGCAGGTCCATGATGCTATGAAGAACG
ATGGTTTTCTCTTTGTCACCAATCATAGTGTCACTCCCCAGCAGGTCTGTTCCTATGTTAAGCCTCCATATGAAA
GCCATAACGTTCCCAGATGTCTAGAATGTTTGATCTTTCTAACTACGCTGTTGATAATGTCAGCGACGAGGAGAA
ACAGAATTATGTTGGGAATATGAGAGAAAACGGAACCTATCGTGGATACAAGCCCCGCAAGTTCTGGGTCAGTGG
CGTCAATGCTCTCAAGCCTGGACGAGACTCATCATTTACTAGCACATTGCTGGGGGTGTTCGCGATCAAATTGAA
CAATACAACAGTATGTACTTATTTTCTGTGCATTGAGGAACAGATTTAACTTTGACTATAATCAACTCACAGTGA
ACTTCCGAGAAATTAAGGATGGAACCCATCCAGAACCTCTTAGGCCGTTCCTATCTGAAATCGACGCTTTCTCGG
ATCAAATCCACTCTGATATAATTAACACAATTCTTCGGTACGTTGTGTTCTTTTGGAGAGCTGTTCTGTTTATAC
TGATGAGAATACCAGTCTCATCGCAATGAGCTTGGAGCTAGATGAAGATTACTTCATCCAGATGCATGATCGTTC
TGCGAACGCAGAAACATTCCGTGAGCCCTACCTACTCTATGATTAGTTTCCCAGCTAATACCTGTGATTTAGTCC
GGTTTGTGAAATAGTGAGCGAGATTTCTTCTAAATTACTCTATCCACAGCGGAATTTAATGTACTGGGCAGTTTC
CCTCATCCAGAAGAAGAAGAGAATAAATCCGGCGGAGTCTGGTTGAAAGGACATACTGGTGTGCAAATTAAGCCC
TAGCATGAGAAATCTGAATTGACCCGGCATATGCAGACTTTATGACGCTAACGTTGCTATTCAGCCAGCCAGTAG
CATCCCTCCAGATAATGACTAAAGATGGGCAATGGAAGTGGGTCAAGCACGTTGAGAATGGAGTTGTAAGGAAGA
TCGTTTCTTTCACCTTTGAATACTACGCTAATCATAATGCAGCTTGTCAATATTGGAGAGGCAATTGAATTCCTG
ACAGGGGGCTACTACAAGCCGACAATCCATAGGTATGATATTCAATGATACTTAATGGCATTGTATATCCATCTC
AATCACAATAGAGTGCGCCAGCCACCTCTGGACCAACAAAACAAGACTAGAGTTGGACTCTTATATTTCTGTAGT
GCTCATGACGATGTCGTACTCAGGCCCATCGCAGAGAGCCCTGTCGTGCAGAAGGGAGGCGACTCTGAGTCTCGC
TTGTTAGACGACAAATTTCCAACTGCGGGTGAATACGGAAAAGCCAGGGTCATGGCTTATGGTGGCACGCAAGCG
CTCAAACAAGATGTTCAGAAAGGAATTGATGAAGAAGTTGTGGCCGGTGTTTTACTTCGGCATTATAATTAAAGA
GTACGAGAGGTGTTCTTAATGCTGTTGCTTCGTATTCATCGGATTTTCCAAGAAATTGCTACTACTACTACAGAA
TTTTATTCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail