Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|067260
Gene name
Locationscaffold_04:639440..643065
Strand+
Gene length (bp)3625
Transcript length (bp)2595
Coding sequence length (bp)2595
Protein length (aa) 865

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 6.8E-41 93 275
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.9E-25 101 276
PF08659 KR KR domain 2.0E-10 95 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 89 365 1.0E-37
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 89 365 3.0E-35
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 93 332 6.0E-32
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 82 274 2.0E-31
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 93 274 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 89 365 1.0E-37
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 89 365 3.0E-35
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 93 332 6.0E-32
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 82 274 2.0E-31
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 93 274 2.0E-31
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 93 274 2.0E-31
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 93 274 2.0E-31
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 93 274 2.0E-31
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 93 274 5.0E-31
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 93 274 6.0E-31
sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 93 274 8.0E-31
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 93 274 7.0E-30
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 93 274 3.0E-28
sp|Q07530|YD114_YEAST Uncharacterized oxidoreductase YDL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL114W PE=3 SV=1 85 328 3.0E-28
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 93 271 1.0E-27
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 93 271 1.0E-27
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 93 271 2.0E-27
sp|O88876|DHRS3_MOUSE Short-chain dehydrogenase/reductase 3 OS=Mus musculus GN=Dhrs3 PE=1 SV=2 125 321 2.0E-27
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 93 271 5.0E-27
sp|O75911|DHRS3_HUMAN Short-chain dehydrogenase/reductase 3 OS=Homo sapiens GN=DHRS3 PE=1 SV=2 125 279 3.0E-26
sp|O77769|DHRS3_BOVIN Short-chain dehydrogenase/reductase 3 OS=Bos taurus GN=DHRS3 PE=2 SV=1 125 279 4.0E-26
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 93 271 8.0E-26
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 93 331 1.0E-25
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 93 271 3.0E-25
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 93 271 3.0E-25
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 93 322 8.0E-25
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 93 321 2.0E-23
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 92 313 5.0E-23
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 93 271 2.0E-22
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 93 271 2.0E-22
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 90 332 1.0E-19
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 90 332 1.0E-19
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 90 332 1.0E-19
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 97 320 6.0E-19
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 92 267 1.0E-18
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 87 273 4.0E-18
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 93 271 5.0E-17
sp|Q1MTR7|YBPE_SCHPO Uncharacterized oxidoreductase C16H5.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.14c PE=3 SV=1 62 329 9.0E-17
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 59 329 1.0E-16
sp|Q06417|TDA5_YEAST Uncharacterized oxidoreductase TDA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA5 PE=1 SV=1 47 347 2.0E-16
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 59 328 2.0E-16
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 92 267 3.0E-16
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 93 278 3.0E-16
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 93 278 3.0E-16
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 93 278 3.0E-16
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 93 278 3.0E-16
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 92 305 5.0E-16
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 93 273 5.0E-16
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 88 271 6.0E-16
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 93 274 6.0E-16
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 96 267 9.0E-16
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 96 267 9.0E-16
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 96 267 9.0E-16
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 96 267 9.0E-16
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 96 267 9.0E-16
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 96 267 9.0E-16
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 60 317 9.0E-16
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 93 278 2.0E-15
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 93 274 2.0E-15
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 93 271 2.0E-15
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 92 271 2.0E-15
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 92 271 2.0E-15
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 93 273 4.0E-15
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 92 278 5.0E-15
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 93 278 6.0E-15
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 96 267 6.0E-15
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 96 267 6.0E-15
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 93 271 6.0E-15
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 95 284 8.0E-15
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 92 305 1.0E-14
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 92 305 1.0E-14
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 90 281 1.0E-14
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 93 273 1.0E-14
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 92 271 1.0E-14
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 93 271 1.0E-14
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 94 267 1.0E-14
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 93 273 2.0E-14
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 96 250 2.0E-14
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 93 273 2.0E-14
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 88 277 2.0E-14
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 92 305 2.0E-14
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 92 305 2.0E-14
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 92 305 2.0E-14
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 92 305 2.0E-14
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 92 305 2.0E-14
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 93 273 3.0E-14
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 88 277 3.0E-14
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 93 271 4.0E-14
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 92 293 4.0E-14
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 93 278 6.0E-14
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 95 273 7.0E-14
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 95 273 7.0E-14
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 45 328 8.0E-14
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 96 250 9.0E-14
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 89 274 1.0E-13
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 96 284 1.0E-13
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 87 273 1.0E-13
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 93 313 2.0E-13
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 93 313 2.0E-13
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 93 313 2.0E-13
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 93 313 2.0E-13
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 93 313 2.0E-13
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 93 313 2.0E-13
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 93 273 2.0E-13
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 92 250 2.0E-13
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 93 271 2.0E-13
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 93 273 2.0E-13
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 64 267 2.0E-13
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 93 268 2.0E-13
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 92 273 3.0E-13
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 91 305 3.0E-13
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 93 273 4.0E-13
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 87 273 4.0E-13
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 94 278 5.0E-13
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 94 278 5.0E-13
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 93 286 5.0E-13
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 94 278 5.0E-13
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 93 271 6.0E-13
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 93 284 6.0E-13
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 86 273 6.0E-13
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 86 273 6.0E-13
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 86 273 6.0E-13
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 92 275 7.0E-13
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 93 271 9.0E-13
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 88 273 9.0E-13
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 88 267 9.0E-13
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 74 273 1.0E-12
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 74 273 1.0E-12
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 95 275 1.0E-12
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 93 305 1.0E-12
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 93 250 1.0E-12
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 93 250 1.0E-12
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 93 273 1.0E-12
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 92 273 1.0E-12
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 125 266 1.0E-12
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 94 278 2.0E-12
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 93 249 2.0E-12
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 93 249 2.0E-12
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 93 249 2.0E-12
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 92 275 2.0E-12
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 93 286 3.0E-12
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 95 275 3.0E-12
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 93 286 3.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 93 273 3.0E-12
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 91 273 4.0E-12
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 93 275 5.0E-12
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 93 275 5.0E-12
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 92 273 5.0E-12
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 92 314 7.0E-12
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 90 273 8.0E-12
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 59 273 1.0E-11
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 93 280 1.0E-11
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 93 275 1.0E-11
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 92 279 1.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 92 282 2.0E-11
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 93 242 2.0E-11
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 96 280 2.0E-11
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 71 273 2.0E-11
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 95 250 2.0E-11
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 93 267 2.0E-11
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 92 275 2.0E-11
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 93 242 2.0E-11
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 92 273 2.0E-11
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 92 273 2.0E-11
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 59 328 2.0E-11
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 92 273 3.0E-11
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 93 267 3.0E-11
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 93 267 3.0E-11
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 88 273 3.0E-11
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 93 267 3.0E-11
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 94 273 3.0E-11
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 92 273 4.0E-11
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 93 266 4.0E-11
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 93 273 4.0E-11
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 92 287 4.0E-11
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 93 267 5.0E-11
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 90 305 5.0E-11
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 88 279 5.0E-11
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 82 273 5.0E-11
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 93 282 5.0E-11
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 93 278 6.0E-11
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 68 314 6.0E-11
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 93 276 6.0E-11
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 92 273 7.0E-11
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 88 271 9.0E-11
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 88 273 1.0E-10
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 93 281 1.0E-10
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 93 275 1.0E-10
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 94 275 1.0E-10
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 93 276 1.0E-10
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 94 280 1.0E-10
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 140 271 1.0E-10
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 57 273 2.0E-10
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 93 276 2.0E-10
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 93 273 2.0E-10
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 96 276 2.0E-10
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 93 273 2.0E-10
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 93 275 2.0E-10
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 93 276 2.0E-10
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 68 275 3.0E-10
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 93 274 3.0E-10
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 93 314 3.0E-10
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 96 339 4.0E-10
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 94 246 4.0E-10
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 96 280 4.0E-10
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 93 266 4.0E-10
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 93 325 5.0E-10
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 94 246 5.0E-10
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 130 273 6.0E-10
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 94 267 6.0E-10
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 93 314 6.0E-10
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 92 273 7.0E-10
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 92 273 7.0E-10
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 96 339 1.0E-09
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 94 281 1.0E-09
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 93 250 1.0E-09
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 163 271 1.0E-09
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 95 271 1.0E-09
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 92 276 2.0E-09
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 93 278 2.0E-09
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 94 259 2.0E-09
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 93 250 2.0E-09
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 93 279 2.0E-09
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 92 249 2.0E-09
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 85 266 2.0E-09
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 95 250 2.0E-09
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 96 339 2.0E-09
sp|Q1RKB7|FABG_RICBR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 130 273 2.0E-09
sp|Q01198|LIGD_SPHPI C alpha-dehydrogenase OS=Sphingomonas paucimobilis GN=ligD PE=3 SV=1 87 273 3.0E-09
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 94 280 3.0E-09
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 163 273 3.0E-09
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 93 288 3.0E-09
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 93 296 3.0E-09
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 93 320 4.0E-09
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 93 320 4.0E-09
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 92 250 4.0E-09
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 92 250 4.0E-09
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 84 273 4.0E-09
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 89 275 4.0E-09
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 89 275 5.0E-09
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 93 276 5.0E-09
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 93 262 6.0E-09
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 93 249 6.0E-09
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 93 320 6.0E-09
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 92 271 7.0E-09
sp|P23170|25KD_SARPE Development-specific 25 kDa protein OS=Sarcophaga peregrina PE=2 SV=1 87 273 7.0E-09
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 124 250 8.0E-09
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 124 250 8.0E-09
sp|Q92RN6|GALD_RHIME Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 85 267 8.0E-09
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 93 273 8.0E-09
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 89 275 9.0E-09
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 93 272 9.0E-09
sp|P06235|NODG_RHIML Nodulation protein G OS=Rhizobium meliloti GN=nodG PE=3 SV=1 96 247 1.0E-08
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 89 275 1.0E-08
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 96 287 1.0E-08
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 96 293 1.0E-08
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 93 271 1.0E-08
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 70 278 2.0E-08
sp|P05707|SRLD_ECOLI Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 93 250 2.0E-08
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 93 271 2.0E-08
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 62 271 2.0E-08
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 96 273 2.0E-08
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 92 271 2.0E-08
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 92 273 2.0E-08
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 96 266 2.0E-08
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 93 273 2.0E-08
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 93 273 2.0E-08
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 93 270 2.0E-08
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 87 253 2.0E-08
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 93 303 2.0E-08
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 93 267 2.0E-08
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 94 250 2.0E-08
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 94 271 3.0E-08
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 89 275 3.0E-08
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 93 273 3.0E-08
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 95 273 3.0E-08
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 93 267 3.0E-08
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 92 271 3.0E-08
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 93 276 4.0E-08
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 93 266 4.0E-08
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 92 273 4.0E-08
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 95 273 5.0E-08
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 91 274 5.0E-08
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 96 280 5.0E-08
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 96 280 5.0E-08
sp|Q4V8B7|HSDL1_RAT Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Rattus norvegicus GN=Hsdl1 PE=2 SV=1 83 339 6.0E-08
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 97 271 6.0E-08
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 88 271 6.0E-08
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 96 277 7.0E-08
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 133 283 7.0E-08
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 93 268 7.0E-08
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 96 273 8.0E-08
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 64 267 8.0E-08
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 93 268 8.0E-08
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 81 253 9.0E-08
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 93 250 9.0E-08
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 93 273 9.0E-08
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 89 271 9.0E-08
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 91 268 1.0E-07
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 58 295 1.0E-07
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 90 273 1.0E-07
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 93 271 1.0E-07
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 88 249 1.0E-07
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 93 276 1.0E-07
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 67 273 1.0E-07
sp|Q8BTX9|HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus GN=Hsdl1 PE=1 SV=1 83 339 2.0E-07
sp|Q70UN9|ADH1_CERCO Alcohol dehydrogenase 1 OS=Ceratitis cosyra GN=ADH1 PE=3 SV=1 95 273 2.0E-07
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 93 284 2.0E-07
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 85 249 2.0E-07
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 93 271 2.0E-07
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 93 267 2.0E-07
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 93 273 2.0E-07
sp|Q5ZJZ5|BDH_CHICK D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Gallus gallus GN=BDH1 PE=2 SV=1 164 268 2.0E-07
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 93 253 2.0E-07
sp|Q6MGB5|DHB8_RAT Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 94 271 2.0E-07
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 93 266 3.0E-07
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 93 275 3.0E-07
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 93 275 3.0E-07
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 55 253 3.0E-07
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 93 271 3.0E-07
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 81 253 3.0E-07
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 93 273 4.0E-07
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 93 274 4.0E-07
sp|Q93UV4|FLNB_TERSD Fluoren-9-ol dehydrogenase OS=Terrabacter sp. (strain DBF63) GN=flnB PE=1 SV=1 93 274 4.0E-07
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 93 260 5.0E-07
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 82 273 6.0E-07
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 92 271 7.0E-07
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 62 273 8.0E-07
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 93 271 8.0E-07
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 96 253 9.0E-07
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 88 274 1.0E-06
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 93 271 1.0E-06
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 96 273 1.0E-06
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 93 266 1.0E-06
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 47 251 1.0E-06
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 95 250 1.0E-06
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 93 273 1.0E-06
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 82 295 1.0E-06
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 93 318 2.0E-06
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 67 252 2.0E-06
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 64 273 2.0E-06
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 96 250 2.0E-06
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 93 280 2.0E-06
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 93 271 2.0E-06
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 92 273 3.0E-06
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 93 276 3.0E-06
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 79 267 3.0E-06
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 93 293 3.0E-06
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 93 273 3.0E-06
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 93 267 3.0E-06
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 55 253 3.0E-06
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 96 266 3.0E-06
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 92 266 3.0E-06
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 130 273 4.0E-06
sp|O55240|RDH1_MOUSE 11-cis retinol dehydrogenase OS=Mus musculus GN=Rdh5 PE=1 SV=1 92 271 4.0E-06
sp|Q70UP6|ADH2_CERRO Alcohol dehydrogenase 2 OS=Ceratitis rosa GN=ADH2 PE=3 SV=1 95 273 4.0E-06
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 57 271 4.0E-06
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 96 273 4.0E-06
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 57 271 4.0E-06
sp|Q70UP5|ADH2_CERCO Alcohol dehydrogenase 2 OS=Ceratitis cosyra GN=ADH2 PE=3 SV=1 95 273 5.0E-06
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 93 273 5.0E-06
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 88 249 5.0E-06
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 93 313 6.0E-06
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 84 273 6.0E-06
sp|Q10130|DHS5_CAEEL Uncharacterized oxidoreductase dhs-5 OS=Caenorhabditis elegans GN=dhs-5 PE=3 SV=2 24 308 6.0E-06
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 94 277 6.0E-06
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 96 249 6.0E-06
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 93 282 6.0E-06
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 82 295 7.0E-06
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 91 277 9.0E-06
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 82 292 9.0E-06
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 125 271 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 51 73 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|067260
MPPHAESTLVFDSFDLDLVVKVLTQTAFSPFFTSFVPVFYFFQGAKLTDPIVVNSALYCLAVCLFRLLTWISTLY
RNQRSIFSAPSLLDWGEQIVVITGGSSGIGELLANTLAVRNVTVVVLDVEPIQTENYNITYYKCDVSQWSEVEAI
ARRIRDEIGEPTILVNNAGVVQGKLILDLNEKDVQQTFGVNALAHWWTIKAFLPDMIKKKSGHIVTLSSVMGIVG
SPQMTDYCGSKAAVRSLNETLRFELDNHYKAPGIRTTLACPGHTRTRLFATFSVPGHWLYQFFFTSVQPIDIVKP
IISALDAQESRTIMVPFFVNLTGYINHLPSFLIDFAQYVACSTYAMKNFRKISGRREEEGPLETQVWFTGSASMT
ADGLPLRPAPPSWHRLIRTPQKQPPAAIAAASCMPHEDMWPPCEPAEITDISPFEANKHVAMRIYQEDSSWAEYR
DRDVLRDYFRDPTNIVLHSNCPHITPHIVISPAPETPEDFYTPWNNCTLPQWSGFLMVPPYDLTTGRLRSPHQLL
SKKADPRCASDDTIVNEDSKSEEKSLISSNDKKHAFSRSQFDSFVESTANERLILYHVVKALQKHLCKAVAYAAS
AHAATFCRRYEMPELLDSVERPFVWVDPAEPILQSNRQMLGGAIIIESSSPLTVPHIIINPAPCQNPWTPWYNVV
TDPQDGRYLTVPSPRVNYINVDLDEEEDLPDSRWSISSAASSRLTLVTDIDEEEDCMGEDADCEDDNDPEEDHSP
PSRPGSPGPETPTDDSASLHGFFPMRPLSFAIDEDDEDRALALAIAKTAVEEYYHSSSLRCSLPVIEEEDSPDEE
GFPPLYLPLGASEDEDLPLGDDWYAGAPTRTSVSTILVV*
Coding >Agabi119p4|067260
ATGCCACCTCACGCAGAGTCGACTCTGGTGTTCGACAGCTTCGACTTGGACCTGGTGGTCAAAGTCCTGACTCAG
ACCGCATTCAGTCCATTCTTTACATCCTTCGTCCCTGTTTTTTATTTCTTTCAAGGCGCTAAACTTACCGACCCG
ATTGTGGTCAACTCGGCTCTCTATTGCTTGGCTGTTTGCTTGTTTCGGCTCTTAACATGGATATCAACTTTGTAC
CGGAATCAAAGAAGCATATTCTCCGCGCCCAGTCTATTAGACTGGGGCGAGCAAATTGTGGTTATAACGGGAGGC
TCTTCCGGCATTGGAGAACTCCTTGCTAATACTCTTGCTGTTCGAAACGTCACGGTCGTGGTTCTTGATGTAGAG
CCTATTCAGACCGAAAACTATAATATCACGTATTACAAGTGTGATGTGTCTCAATGGTCAGAGGTGGAAGCCATT
GCAAGACGTATTAGAGACGAAATCGGAGAGCCTACCATCCTTGTTAATAACGCGGGCGTTGTCCAAGGAAAGTTG
ATCCTCGATTTAAATGAGAAGGATGTTCAGCAGACATTCGGCGTCAATGCTCTAGCTCACTGGTGGACCATTAAA
GCGTTCCTTCCGGATATGATCAAGAAGAAATCGGGCCATATTGTAACCCTTTCCTCTGTCATGGGCATCGTGGGT
TCCCCGCAGATGACTGACTACTGTGGCAGCAAAGCCGCTGTACGTTCCCTGAACGAGACCCTCCGTTTTGAGCTT
GATAATCACTACAAAGCTCCTGGAATTCGTACGACACTTGCATGTCCCGGGCACACCAGGACGCGACTTTTTGCG
ACCTTTTCAGTGCCGGGTCACTGGCTCTACCAGTTTTTCTTCACCTCGGTACAGCCCATCGATATTGTCAAACCG
ATCATCTCCGCCCTTGATGCCCAAGAGTCGCGGACAATTATGGTTCCCTTCTTTGTCAACCTGACAGGCTACATC
AACCATCTACCAAGTTTCTTGATTGACTTTGCACAATATGTCGCTTGCTCGACATATGCGATGAAAAACTTTAGA
AAGATAAGCGGGAGGCGAGAGGAGGAGGGACCCTTGGAAACACAGGTGTGGTTCACTGGATCAGCATCAATGACA
GCGGACGGCCTTCCTCTGCGCCCGGCGCCTCCATCTTGGCACCGCCTGATCCGCACCCCTCAAAAGCAGCCTCCC
GCCGCCATCGCAGCTGCCTCATGTATGCCCCATGAGGACATGTGGCCCCCATGTGAACCAGCTGAAATAACCGAC
ATCTCGCCCTTCGAAGCGAACAAGCACGTCGCCATGCGCATATATCAAGAGGACTCCAGTTGGGCGGAATACCGC
GACAGGGATGTTCTGCGAGATTACTTCAGAGACCCAACCAACATCGTCCTGCACTCAAATTGCCCGCATATAACA
CCGCATATAGTCATATCCCCGGCACCTGAAACGCCTGAAGATTTCTACACCCCATGGAATAACTGCACGCTCCCT
CAGTGGTCTGGCTTTCTGATGGTCCCGCCATACGACTTGACCACCGGGCGACTACGCTCTCCCCACCAACTCCTT
TCTAAAAAAGCCGATCCTCGGTGTGCTAGTGACGATACTATCGTCAACGAGGACTCAAAAAGTGAAGAAAAATCA
CTTATTTCTTCAAATGACAAAAAACATGCTTTCTCTCGTTCTCAGTTCGACTCGTTTGTCGAGTCAACTGCCAAT
GAACGATTGATATTGTATCATGTGGTCAAAGCACTTCAAAAGCACCTATGTAAAGCTGTGGCATATGCTGCTAGC
GCTCACGCTGCGACGTTTTGTCGTCGTTATGAAATGCCAGAGTTACTTGACTCGGTTGAACGACCGTTTGTTTGG
GTCGACCCTGCTGAGCCCATTCTCCAGAGCAATAGGCAAATGCTTGGTGGAGCTATCATTATCGAGTCATCTTCC
CCCCTCACTGTACCGCATATCATTATCAACCCCGCGCCTTGCCAGAATCCTTGGACTCCGTGGTATAACGTCGTC
ACCGATCCCCAAGATGGGCGATATCTCACTGTTCCTTCTCCCCGTGTCAATTATATTAATGTGGATCTGGACGAA
GAGGAAGACTTGCCCGACTCCAGATGGTCGATATCATCTGCTGCTTCCTCGCGGCTGACCTTGGTAACTGATATC
GACGAGGAAGAAGATTGTATGGGAGAAGATGCTGATTGCGAGGACGACAACGATCCCGAAGAGGATCATTCGCCA
CCTTCACGACCTGGCTCTCCGGGACCTGAGACGCCGACAGATGATTCTGCATCTCTCCACGGGTTCTTTCCCATG
CGGCCACTAAGCTTTGCTATTGACGAAGACGATGAGGATCGTGCCTTGGCCCTTGCCATTGCCAAAACAGCAGTA
GAAGAGTACTATCATAGTTCTTCTCTTCGTTGTTCTCTACCGGTGATTGAAGAAGAAGATTCTCCTGACGAGGAA
GGATTCCCCCCTTTGTATCTTCCTCTCGGAGCGAGTGAAGACGAAGATTTACCTTTAGGGGACGATTGGTATGCA
GGAGCACCTACACGAACATCGGTGTCGACTATACTTGTCGTATAA
Transcript >Agabi119p4|067260
ATGCCACCTCACGCAGAGTCGACTCTGGTGTTCGACAGCTTCGACTTGGACCTGGTGGTCAAAGTCCTGACTCAG
ACCGCATTCAGTCCATTCTTTACATCCTTCGTCCCTGTTTTTTATTTCTTTCAAGGCGCTAAACTTACCGACCCG
ATTGTGGTCAACTCGGCTCTCTATTGCTTGGCTGTTTGCTTGTTTCGGCTCTTAACATGGATATCAACTTTGTAC
CGGAATCAAAGAAGCATATTCTCCGCGCCCAGTCTATTAGACTGGGGCGAGCAAATTGTGGTTATAACGGGAGGC
TCTTCCGGCATTGGAGAACTCCTTGCTAATACTCTTGCTGTTCGAAACGTCACGGTCGTGGTTCTTGATGTAGAG
CCTATTCAGACCGAAAACTATAATATCACGTATTACAAGTGTGATGTGTCTCAATGGTCAGAGGTGGAAGCCATT
GCAAGACGTATTAGAGACGAAATCGGAGAGCCTACCATCCTTGTTAATAACGCGGGCGTTGTCCAAGGAAAGTTG
ATCCTCGATTTAAATGAGAAGGATGTTCAGCAGACATTCGGCGTCAATGCTCTAGCTCACTGGTGGACCATTAAA
GCGTTCCTTCCGGATATGATCAAGAAGAAATCGGGCCATATTGTAACCCTTTCCTCTGTCATGGGCATCGTGGGT
TCCCCGCAGATGACTGACTACTGTGGCAGCAAAGCCGCTGTACGTTCCCTGAACGAGACCCTCCGTTTTGAGCTT
GATAATCACTACAAAGCTCCTGGAATTCGTACGACACTTGCATGTCCCGGGCACACCAGGACGCGACTTTTTGCG
ACCTTTTCAGTGCCGGGTCACTGGCTCTACCAGTTTTTCTTCACCTCGGTACAGCCCATCGATATTGTCAAACCG
ATCATCTCCGCCCTTGATGCCCAAGAGTCGCGGACAATTATGGTTCCCTTCTTTGTCAACCTGACAGGCTACATC
AACCATCTACCAAGTTTCTTGATTGACTTTGCACAATATGTCGCTTGCTCGACATATGCGATGAAAAACTTTAGA
AAGATAAGCGGGAGGCGAGAGGAGGAGGGACCCTTGGAAACACAGGTGTGGTTCACTGGATCAGCATCAATGACA
GCGGACGGCCTTCCTCTGCGCCCGGCGCCTCCATCTTGGCACCGCCTGATCCGCACCCCTCAAAAGCAGCCTCCC
GCCGCCATCGCAGCTGCCTCATGTATGCCCCATGAGGACATGTGGCCCCCATGTGAACCAGCTGAAATAACCGAC
ATCTCGCCCTTCGAAGCGAACAAGCACGTCGCCATGCGCATATATCAAGAGGACTCCAGTTGGGCGGAATACCGC
GACAGGGATGTTCTGCGAGATTACTTCAGAGACCCAACCAACATCGTCCTGCACTCAAATTGCCCGCATATAACA
CCGCATATAGTCATATCCCCGGCACCTGAAACGCCTGAAGATTTCTACACCCCATGGAATAACTGCACGCTCCCT
CAGTGGTCTGGCTTTCTGATGGTCCCGCCATACGACTTGACCACCGGGCGACTACGCTCTCCCCACCAACTCCTT
TCTAAAAAAGCCGATCCTCGGTGTGCTAGTGACGATACTATCGTCAACGAGGACTCAAAAAGTGAAGAAAAATCA
CTTATTTCTTCAAATGACAAAAAACATGCTTTCTCTCGTTCTCAGTTCGACTCGTTTGTCGAGTCAACTGCCAAT
GAACGATTGATATTGTATCATGTGGTCAAAGCACTTCAAAAGCACCTATGTAAAGCTGTGGCATATGCTGCTAGC
GCTCACGCTGCGACGTTTTGTCGTCGTTATGAAATGCCAGAGTTACTTGACTCGGTTGAACGACCGTTTGTTTGG
GTCGACCCTGCTGAGCCCATTCTCCAGAGCAATAGGCAAATGCTTGGTGGAGCTATCATTATCGAGTCATCTTCC
CCCCTCACTGTACCGCATATCATTATCAACCCCGCGCCTTGCCAGAATCCTTGGACTCCGTGGTATAACGTCGTC
ACCGATCCCCAAGATGGGCGATATCTCACTGTTCCTTCTCCCCGTGTCAATTATATTAATGTGGATCTGGACGAA
GAGGAAGACTTGCCCGACTCCAGATGGTCGATATCATCTGCTGCTTCCTCGCGGCTGACCTTGGTAACTGATATC
GACGAGGAAGAAGATTGTATGGGAGAAGATGCTGATTGCGAGGACGACAACGATCCCGAAGAGGATCATTCGCCA
CCTTCACGACCTGGCTCTCCGGGACCTGAGACGCCGACAGATGATTCTGCATCTCTCCACGGGTTCTTTCCCATG
CGGCCACTAAGCTTTGCTATTGACGAAGACGATGAGGATCGTGCCTTGGCCCTTGCCATTGCCAAAACAGCAGTA
GAAGAGTACTATCATAGTTCTTCTCTTCGTTGTTCTCTACCGGTGATTGAAGAAGAAGATTCTCCTGACGAGGAA
GGATTCCCCCCTTTGTATCTTCCTCTCGGAGCGAGTGAAGACGAAGATTTACCTTTAGGGGACGATTGGTATGCA
GGAGCACCTACACGAACATCGGTGTCGACTATACTTGTCGTATAA
Gene >Agabi119p4|067260
ATGCCACCTCACGCAGAGTCGACTCTGGTGTTCGACAGCTTCGACTTGGACCTGGTGGTCAAAGTCCTGACTCAG
ACCGCATTCAGTAAGATGCCACGTCGCCCGAGGGCTTTATCTCCGAATATTAACAGTTGTTCTGTTAACCTTCCA
GGTCCATTCTTTACATCCTTCGTCCCTGTTTTTTATTTCTTTCAAGGCGCTAAACTTACCGACCCGATTGTGGTC
AACTCGGCTCTCTATTGCTTGGCTGTTTGCTTGTTTCGTGAGAATCCTTCCGTCGGTTAATGGAAAATACTCGGA
GCTCAATTATCTCAGGGCTCTTAACATGGATATCAACTTTGTACCGGAATCAAAGAAGCATATTCTCCGCGCCCA
GTCTATTAGACTGGGGCGAGCAAATTGTGGTTATAACGGGAGGTCAGTAGCATTGACGTCGATAAAAGTTGTGAA
AATGCTAAGTTTGCTGCAGGCTCTTCCGGCATTGGAGAACTCCTTGCTAATACTCTTGCTGTTCGAAACGTCACG
GTCGTGGTTCTTGATGTAGAGCCTATTCAGACCGAAAACTGTTTGTGCCAATATTACTATCCACACCAACGCCCA
GACTCATGAAAGGATCACAGATAATATCACGTATTACAAGTGTGATGTGTCTCAATGGTCAGAGGTGGAAGCCAT
TGCAAGACGTATTAGAGACGAAGTATGTGCCATGACCGAAGTTGAGATGCTCGAGCCCAACCTTCTATTCTAGAT
CGGAGAGCCTACCATCCTTGTTAATAACGCGGGCGTTGTCCAAGGAAAGTTGATCCTCGATTTAAATGAGAAGGA
TGTTCAGCAGTAAGTTTGATCGTAGCCTCACGAATCGTTGCTCATGGTAGCCCGCCAGGACATTCGGCGTCAATG
CTCTAGCTCACTGGTGGACCATTAAAGCGTTCCTTCCGGATATGATCAAGAAGAAATCGGGCCATATTGTGAGAC
GCGTCTTTAATATTCTATCCCGAGTCTAATCACCGATTGCCAACTAGGTAACCCTTTCCTCTGTCATGGGCATCG
TGGGTTCCCCGCAGATGAGTGAGTTGTGCAAGCACCGAGTCTGTCACGTAGTATGACTTAACTCCGGGTATTAGC
TGACTACTGTGGCAGCAAAGCCGCTGTACGTTCCCTGAACGAGACCCTCCGTTTTGAGCTTGATAATCAGTAAGT
CGTGGAAATGGAAGTGCCTGACTTTTTCACTTACAATGGGTATGCAGCTACAAAGCTCCTGGAATTCGTACGACA
CTTGCATGTCCCGGGCACACCAGGACGCGACTTTTTGCGACCTTTTCAGTGCCGGGTCACTGGCTCTACCAGTTT
TTCTTCACCTCGGTACAGCCCATCGATATTGTCAAACCGATCATCTCCGCCCTTGATGCCCAAGAGTCGCGGACA
ATTATGGTTCCCTTCTTTGTCAACCTGACAGGCTACATCAACCATCTACCAAGTTTCTTGATTGACTTTGCACAA
TATGCAAGTAATATTTTACTTTGTATGGTGAACCCTATCTTAGGTGCTGTTTCTAGGTCGCTTGCTCGACATATG
CGATGAAAAACTTTAGAAAGATAAGCGGGAGGCGAGAGGAGGAGGGACCCTTGGAAACACAGGGTATATATTGAT
GCAGAATAGACGTCGTCGCGGACCCTAGTGAGACTGCATACCTAGACAGTGCTAAATAAGAATGCAAACTGGAGG
TAGAGCCGCGGAAAATGACGTCATGTGTGTGGCCATACAGTGTGGTTCACTGGATCAGCATCAATGACAGCGGAC
GGCCTTCCTCTGCGCCCGGCGCCTCCATCTTGGCACCGGTGCGCTTGTTCCCCTTATCGTCGCGCTTATCACCCA
CTCTTCTTTCCTAGCCTGATCCGCACCCCTCAAAAGCAGCCTCCCGCCGCCATGTCTGTGCCCCAATGAGCACCT
GCAACATTCACGACCCTGTTCACAGCGCAGCTGCCTCATGTATGCCCCATGAGGACATGTGGCCCCCATGTGAAC
CAGCTGAAATAACCGACATCTCGCCCTTCGAAGCGAACAAGCACGTCGCCATGGTACGTGATGTCTTTCACTATG
TCGTCGCTGCTGCCTCACCCGTACCCCTCACTCAGCGCATATATCAAGAGGACTCCAGTTGGGCGGAATACCGCG
ACAGGGTTGGTCTCAATGCGTCCGATTCAAGCAGCACACGTCCAACTGAACCTTTTGTCGCAGGATGTTCTGCGA
GATTACTTCAGAGACCCAACCAACATCGTCCTGCACTCAAATTGCCCGCATATAACACCGCATATAGTCATATCC
CCGGCACCTGAAACGCCTGAAGATTTCTACACCCCATGGAATAACTGCACGCTCCCTCAGTGGTCTGGCTTTCTG
ATGGTCCCGCCATACGACTTGACCACCGGGCGACTACGCTCTCCCCACCAACTCCTTTCTAAAAAAGCCGATCCT
CGGTGTGCTAGTGACGATACTATCGTCAACGAGGACTCAAAAAGTGAAGAAAAATCACTTATTTCTTCAAATGAC
AAAAAACATGCTTTCTCTCGTTCTCAGTTCGACTCGTTTGTAAGCATTCTGCATGTCAGATAGATTCCTGGCTGA
TAATCGATCTAGGTCGAGTCAACTGCCAATGAACGATTGATATTGTATCATGTGGTCAAAGCACTTCAAAAGCAC
CTATGTAAAGCTGTGGTAAGTCTTCTTTACCAGCGCTACTCTTAGAGTTCCCTGACCATTCCCCCAAAAGGCATA
TGCTGCTAGCGCTCACGCTGCGACGTTTTGTCGTCGTTATGAAATGCCAGAGTTACTTGACTCGGTTGAACGACC
GTTTGTTTGGGTCGACCCTGCTGAGGTATGGCATTTCGATCGCGTATTTCCCGTCATTAACAAGCTTTAGCCCAT
TCTCCAGAGCAATAGGCAAATGCTTGGTGGAGCTATCATTATCGAGTCATCTTCCCCCCTCACTGTACCGCATAT
CATTATCAACCCCGCGCCTTGCCAGAATCCTTGGACTCCGTGGTATAACGTCGTCACCGATCCCCAAGATGGGCG
ATATCTCACTGTTCCTTCTCCCCGTGTCAATTATATTAATGTGGATCTGGACGAAGAGGAAGACTTGCCCGACTC
CAGATGGTCGATATCATCTGCTGCTTCCTCGCGGCTGACCTTGGTAACTGATATCGACGAGGAAGAAGATTGTAT
GGGAGAAGATGCTGATTGCGAGGACGACAACGATCCCGAAGAGGATCATTCGCCACCTTCACGACCTGGCTCTCC
GGGACCTGAGACGCCGACAGATGATTCTGCATCTCTCCACGGGTTCTTTCCCATGCGGCCACTAAGCTTTGCTAT
TGACGAAGACGATGAGGATCGTGCCTTGGCCCTTGCCATTGCCAAAACAGCAGTAGAAGAGTACTATCATAGTTC
TTCTCTTCGTTGTTCTCTACCGGTGATTGAAGAAGAAGATTCTCCTGACGAGGAAGGATTCCCCCCTTTGTATCT
TCCTCTCGGAGCGAGTGAAGACGAAGATTTACCTTTAGGGGACGATTGGTATGCAGGAGCACCTACACGAACATC
GGTGTCGACTATACTTGTCGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail