Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|066490
Gene name
Locationscaffold_04:418895..420736
Strand+
Gene length (bp)1841
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 1.2E-33 18 146
PF00782 DSPc Dual specificity phosphatase, catalytic domain 3.5E-09 202 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 14 147 1.0E-23
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 13 147 4.0E-21
sp|Q6B8I1|DS13A_HUMAN Dual specificity protein phosphatase 13 isoform A OS=Homo sapiens GN=DUSP13 PE=1 SV=1 5 151 5.0E-20
sp|Q6B8I0|DS13A_MOUSE Dual specificity protein phosphatase 13 isoform A OS=Mus musculus GN=Dusp13 PE=2 SV=1 5 151 1.0E-19
sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 57 169 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 14 147 1.0E-23
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 13 147 4.0E-21
sp|Q6B8I1|DS13A_HUMAN Dual specificity protein phosphatase 13 isoform A OS=Homo sapiens GN=DUSP13 PE=1 SV=1 5 151 5.0E-20
sp|Q6B8I0|DS13A_MOUSE Dual specificity protein phosphatase 13 isoform A OS=Mus musculus GN=Dusp13 PE=2 SV=1 5 151 1.0E-19
sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 57 169 4.0E-19
sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 17 151 5.0E-19
sp|P51452|DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens GN=DUSP3 PE=1 SV=1 17 151 5.0E-19
sp|Q6IVY4|SSH_XENLA Protein phosphatase Slingshot homolog OS=Xenopus laevis GN=ssh PE=1 SV=2 18 145 6.0E-19
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 18 145 1.0E-18
sp|Q9D7X3|DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus GN=Dusp3 PE=1 SV=1 17 151 1.0E-18
sp|Q39491|PTP3_CHLMO Dual specificity protein phosphatase OS=Chlamydomonas moewusii GN=VH-PTP13 PE=1 SV=1 11 142 2.0E-18
sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 11 147 3.0E-18
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 18 157 3.0E-18
sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 18 146 9.0E-18
sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 18 164 1.0E-17
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 18 145 3.0E-17
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 60 147 3.0E-17
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 11 147 5.0E-17
sp|Q8R4V2|DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus GN=Dusp15 PE=2 SV=3 18 146 6.0E-17
sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 18 145 7.0E-17
sp|Q9C5S1|MKP1_ARATH Protein-tyrosine-phosphatase MKP1 OS=Arabidopsis thaliana GN=MKP1 PE=1 SV=1 14 142 8.0E-17
sp|Q4G0W2|DUS28_HUMAN Dual specificity phosphatase 28 OS=Homo sapiens GN=DUSP28 PE=2 SV=1 18 147 9.0E-17
sp|Q8BTR5|DUS28_MOUSE Dual specificity phosphatase 28 OS=Mus musculus GN=Dusp28 PE=1 SV=1 18 147 9.0E-17
sp|Q9H1R2|DUS15_HUMAN Dual specificity protein phosphatase 15 OS=Homo sapiens GN=DUSP15 PE=1 SV=4 18 146 1.0E-16
sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 3 163 2.0E-16
sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 13 147 2.0E-16
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 18 147 3.0E-16
sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 3 163 3.0E-16
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 18 147 3.0E-16
sp|Q75QN6|DPHS1_ARATH Dual specificity protein phosphatase PHS1 OS=Arabidopsis thaliana GN=PHS1 PE=1 SV=1 1 166 6.0E-16
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 18 142 8.0E-16
sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 12 142 8.0E-16
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 12 142 9.0E-16
sp|Q60969|STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus GN=Styx PE=1 SV=2 18 145 1.0E-15
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 18 142 2.0E-15
sp|Q5RDP3|STYX_PONAB Serine/threonine/tyrosine-interacting protein OS=Pongo abelii GN=STYX PE=2 SV=1 12 145 2.0E-15
sp|Q8WUJ0|STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens GN=STYX PE=1 SV=1 12 145 2.0E-15
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 18 142 2.0E-15
sp|Q17QJ3|DUS26_BOVIN Dual specificity protein phosphatase 26 OS=Bos taurus GN=DUSP26 PE=2 SV=1 18 142 3.0E-15
sp|Q9PW71|DUS4_CHICK Dual specificity protein phosphatase 4 OS=Gallus gallus GN=DUSP4 PE=2 SV=1 18 142 5.0E-15
sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 3 163 6.0E-15
sp|Q5XIS1|SSH3_RAT Protein phosphatase Slingshot homolog 3 OS=Rattus norvegicus GN=Ssh3 PE=1 SV=1 18 145 7.0E-15
sp|Q4V7N3|STYXA_XENLA Serine/threonine/tyrosine-interacting protein A OS=Xenopus laevis GN=styx-a PE=2 SV=1 33 145 8.0E-15
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 7 147 9.0E-15
sp|Q6GQJ8|DUS22_XENLA Dual specificity protein phosphatase 22 OS=Xenopus laevis GN=dusp22 PE=2 SV=1 18 164 1.0E-14
sp|Q8TE77|SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens GN=SSH3 PE=1 SV=2 18 145 1.0E-14
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 12 145 1.0E-14
sp|Q55E39|DUSP1_DICDI Probable dual specificity protein phosphatase DDB_G0269404 OS=Dictyostelium discoideum GN=DDB_G0269404 PE=3 SV=1 12 145 1.0E-14
sp|Q10038|VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans GN=vhp-1 PE=1 SV=2 58 145 2.0E-14
sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 18 142 2.0E-14
sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 18 142 2.0E-14
sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 18 142 2.0E-14
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 18 147 3.0E-14
sp|Q62767|DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus GN=Dusp4 PE=2 SV=1 18 142 3.0E-14
sp|Q13115|DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens GN=DUSP4 PE=1 SV=1 18 142 3.0E-14
sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 18 145 4.0E-14
sp|Q8BFV3|DUS4_MOUSE Dual specificity protein phosphatase 4 OS=Mus musculus GN=Dusp4 PE=2 SV=1 18 142 4.0E-14
sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 18 145 5.0E-14
sp|Q8WYL5|SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens GN=SSH1 PE=1 SV=2 13 145 5.0E-14
sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=1 SV=2 18 142 6.0E-14
sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 18 142 6.0E-14
sp|Q76I79|SSH1_MOUSE Protein phosphatase Slingshot homolog 1 OS=Mus musculus GN=Ssh1 PE=1 SV=1 13 145 6.0E-14
sp|Q8K4T5|DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus GN=Dusp19 PE=2 SV=1 13 145 7.0E-14
sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 7 166 8.0E-14
sp|Q9UII6|DS13B_HUMAN Dual specificity protein phosphatase 13 isoform B OS=Homo sapiens GN=DUSP13 PE=1 SV=3 18 144 1.0E-13
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 18 147 1.0E-13
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 18 147 1.0E-13
sp|Q9QYJ7|DS13B_MOUSE Dual specificity protein phosphatase 13 isoform B OS=Mus musculus GN=Dusp13 PE=1 SV=1 5 142 1.0E-13
sp|Q5U593|STYXB_XENLA Serine/threonine/tyrosine-interacting protein B OS=Xenopus laevis GN=styx-b PE=2 SV=1 18 145 1.0E-13
sp|Q05923|DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens GN=DUSP2 PE=1 SV=1 18 145 1.0E-13
sp|Q5XHB2|DUS22_XENTR Dual specificity protein phosphatase 22 OS=Xenopus tropicalis GN=dusp22 PE=2 SV=1 18 164 3.0E-13
sp|Q9NRW4|DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens GN=DUSP22 PE=1 SV=1 18 166 3.0E-13
sp|Q566R7|DS22B_DANRE Dual specificity protein phosphatase 22-B OS=Danio rerio GN=dusp22b PE=2 SV=2 18 174 3.0E-13
sp|Q68J44|DUPD1_HUMAN Dual specificity phosphatase DUPD1 OS=Homo sapiens GN=DUPD1 PE=1 SV=1 17 142 1.0E-12
sp|Q02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVH1 PE=1 SV=1 2 166 1.0E-12
sp|P0C594|DUPD1_PANTR Dual specificity phosphatase DUPD1 OS=Pan troglodytes GN=DUPD1 PE=3 SV=1 17 142 2.0E-12
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 2 147 2.0E-12
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 2 147 2.0E-12
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 2 147 2.0E-12
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 2 147 2.0E-12
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 18 150 2.0E-12
sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 1 150 4.0E-12
sp|P0C596|DUPD1_PIG Dual specificity phosphatase DUPD1 OS=Sus scrofa GN=DUPD1 PE=3 SV=1 17 147 5.0E-12
sp|Q55BI8|DUSP3_DICDI Probable dual specificity protein phosphatase DDB_G0271350 OS=Dictyostelium discoideum GN=DDB_G0271350 PE=3 SV=1 11 142 9.0E-12
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 18 142 1.0E-11
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 18 142 1.0E-11
sp|O95147|DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens GN=DUSP14 PE=1 SV=1 1 150 1.0E-11
sp|Q17QM8|DUS14_BOVIN Dual specificity protein phosphatase 14 OS=Bos taurus GN=DUSP14 PE=2 SV=1 1 150 1.0E-11
sp|P0C599|DUPD1_TAKRU Dual specificity phosphatase DUPD1 OS=Takifugu rubripes GN=dupd1 PE=3 SV=1 18 142 1.0E-11
sp|P0C595|DUPD1_RAT Dual specificity phosphatase DUPD1 OS=Rattus norvegicus GN=Dupd1 PE=2 SV=1 17 147 2.0E-11
sp|Q8BK84|DUPD1_MOUSE Dual specificity phosphatase DUPD1 OS=Mus musculus GN=Dupd1 PE=2 SV=1 17 147 2.0E-11
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 18 142 3.0E-11
sp|P0C592|DUPD1_HORSE Dual specificity phosphatase DUPD1 OS=Equus caballus GN=DUPD1 PE=3 SV=2 17 147 3.0E-11
sp|Q5UR74|PTPH_MIMIV Putative tyrosine-protein phosphatase R622 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R622 PE=3 SV=1 79 145 6.0E-11
sp|P0C591|DUPD1_BOVIN Dual specificity phosphatase DUPD1 OS=Bos taurus GN=DUPD1 PE=2 SV=1 17 142 8.0E-11
sp|P0C5A1|DUPD1_ORYLA Dual specificity phosphatase DUPD1 OS=Oryzias latipes GN=dupd1 PE=3 SV=1 17 142 1.0E-10
sp|P0C593|DUPD1_MONDO Dual specificity phosphatase DUPD1 OS=Monodelphis domestica GN=DUPD1 PE=3 SV=1 17 142 1.0E-10
sp|Q85297|DUSP_MYXVL Probable dual specificity protein phosphatase H1 homolog OS=Myxoma virus (strain Lausanne) GN=m069L PE=1 SV=2 16 125 2.0E-10
sp|P0C597|DUPD1_CHICK Dual specificity phosphatase DUPD1 OS=Gallus gallus GN=DUPD1 PE=2 SV=1 8 142 2.0E-10
sp|Q29RA3|DUPD1_DANRE Dual specificity phosphatase DUPD1 OS=Danio rerio GN=dupd1 PE=2 SV=1 18 142 2.0E-10
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 12 150 3.0E-10
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 12 147 3.0E-10
sp|P0C5A2|DUPD1_CALMI Dual specificity phosphatase DUPD1 OS=Callorhinchus milii GN=dupd1 PE=3 SV=1 18 144 3.0E-10
sp|Q9Y6J8|STYL1_HUMAN Serine/threonine/tyrosine-interacting-like protein 1 OS=Homo sapiens GN=STYXL1 PE=2 SV=1 4 159 4.0E-10
sp|Q5VZP5|DUS27_HUMAN Inactive dual specificity phosphatase 27 OS=Homo sapiens GN=DUSP27 PE=2 SV=1 33 142 5.0E-10
sp|P0C598|DUPD1_ANOCA Dual specificity phosphatase DUPD1 OS=Anolis carolinensis GN=DUPD1 PE=3 SV=1 10 142 1.0E-09
sp|Q6AXW7|DUS18_RAT Dual specificity protein phosphatase 18 OS=Rattus norvegicus GN=Dusp18 PE=2 SV=1 8 145 2.0E-09
sp|Q9EMX1|PTPH_AMEPV Putative tyrosine-protein phosphatase AMV078 OS=Amsacta moorei entomopoxvirus GN=AMV078 PE=3 SV=1 9 146 3.0E-09
sp|Q148W8|DUS27_MOUSE Inactive dual specificity phosphatase 27 OS=Mus musculus GN=Dusp27 PE=1 SV=1 33 142 3.0E-09
sp|P0C5A0|DUPD1_GASAC Dual specificity phosphatase DUPD1 OS=Gasterosteus aculeatus GN=dupd1 PE=3 SV=1 18 142 4.0E-09
sp|Q4RQD3|DUPD1_TETNG Dual specificity phosphatase DUPD1 OS=Tetraodon nigroviridis GN=dupd1 PE=3 SV=2 18 142 4.0E-09
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 62 151 7.0E-09
sp|Q9H596|DUS21_HUMAN Dual specificity protein phosphatase 21 OS=Homo sapiens GN=DUSP21 PE=1 SV=1 9 151 7.0E-09
sp|Q5R8X2|DUS18_PONAB Dual specificity protein phosphatase 18 OS=Pongo abelii GN=DUSP18 PE=2 SV=1 6 145 8.0E-09
sp|Q8NEJ0|DUS18_HUMAN Dual specificity protein phosphatase 18 OS=Homo sapiens GN=DUSP18 PE=1 SV=1 6 145 1.0E-08
sp|Q54R42|DUSP2_DICDI Probable dual specificity protein phosphatase DDB_G0283417 OS=Dictyostelium discoideum GN=DDB_G0283417 PE=3 SV=1 87 147 1.0E-08
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 210 323 2.0E-08
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 181 324 2.0E-08
sp|Q9D9D8|DUS21_MOUSE Dual specificity phosphatase 21 OS=Mus musculus GN=Dusp21 PE=1 SV=1 18 145 2.0E-08
sp|P34680|YO42_CAEEL Uncharacterized protein ZK757.2 OS=Caenorhabditis elegans GN=ZK757.2 PE=3 SV=2 58 142 4.0E-08
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 202 423 5.0E-08
sp|A4IHU7|DUPD1_XENTR Dual specificity phosphatase DUPD1 OS=Xenopus tropicalis GN=dupd1 PE=2 SV=2 10 142 1.0E-07
sp|Q8VE01|DUS18_MOUSE Dual specificity protein phosphatase 18 OS=Mus musculus GN=Dusp18 PE=1 SV=1 11 145 1.0E-07
sp|Q5BIP9|DUS18_BOVIN Dual specificity protein phosphatase 18 OS=Bos taurus GN=DUSP18 PE=2 SV=1 57 145 1.0E-07
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 56 147 3.0E-07
sp|Q84JU4|IBR5_ARATH Protein-tyrosine-phosphatase IBR5 OS=Arabidopsis thaliana GN=IBR5 PE=1 SV=1 11 150 6.0E-07
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 233 315 1.0E-06
sp|Q4KL92|DUPD1_XENLA Dual specificity phosphatase DUPD1 OS=Xenopus laevis GN=dupd1 PE=2 SV=2 8 142 1.0E-06
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 181 323 2.0E-06
sp|P40479|SDP1_YEAST Dual-specificity protein phosphatase SDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDP1 PE=1 SV=1 74 142 2.0E-06
sp|P80994|DUSP_RACVI Probable dual specificity protein phosphatase H1 homolog OS=Raccoon poxvirus GN=VH1 PE=2 SV=1 16 115 3.0E-06
sp|P33064|DUSP_VAR67 Dual specificity protein phosphatase H1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=H1L PE=1 SV=1 16 115 6.0E-06
sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 206 340 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016311 dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016787 hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0003824 catalytic activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016791 phosphatase activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|066490
MMSDAAASSTSEILKNQLYLGNVAAVKCPDTRKKLGITHVVSVCHEYCPENGTSDTHLHIPVQDTEYEDLLIYLP
KTTHFIQNALEEGGRVLVHCVMGVSRSTTVVAAFLMKHKKMDARSALRYIKQRRLQAHPNYGFIKQLDTYSKCQF
DPCPTNPVYRSWKKRQEQDVTSFLNQLVDTVSIIPEKLLLSSDFPEDARQAESLLADLGITHVLSISPAELPLSA
LSATLKSENHHYHINVRNNVKEDLLLAMPGAMQFVEEAMADGLVLVHSLMEVRACTIACACLMKQRNLAPDEAYA
LIEDSLPLFNPTVKFSRNLELFDACGYQPTRDHSIVQEWLSSNGPEIGSSQSPGFSPESSRRPSGSIIKSTSSIS
FPKDLRSTTTSREAAISSGSSAPPSSYLSQPMHKRPTSSSRMCNQNHMSPPDTDLGARAKDILSNTGFDLTEFAD
ALKEIEGRPCTSSKKRGNGVQKDVHSPQRKQRAAQSMYC*
Coding >Agabi119p4|066490
ATGATGTCAGATGCTGCAGCCTCTAGCACGAGTGAGATACTCAAAAATCAACTATATCTCGGAAACGTTGCAGCA
GTTAAATGCCCCGACACCAGAAAGAAACTCGGAATAACTCATGTCGTCTCTGTGTGCCACGAATACTGTCCCGAG
AATGGGACATCGGATACCCATCTACATATCCCGGTACAAGACACAGAGTATGAAGACCTCCTAATATACCTGCCC
AAAACTACTCATTTTATTCAAAACGCATTGGAGGAGGGAGGAAGAGTGTTGGTTCATTGTGTAATGGGAGTGTCG
CGGAGTACTACTGTCGTCGCTGCGTTTCTGATGAAGCACAAGAAGATGGATGCTAGATCTGCTTTACGATACATA
AAGCAACGACGGCTACAAGCTCATCCAAATTATGGTTTCATCAAACAACTTGACACCTATTCCAAGTGTCAATTC
GATCCTTGTCCAACCAATCCTGTATACCGCTCTTGGAAGAAACGACAGGAGCAAGACGTTACTTCCTTCCTCAAC
CAGCTTGTTGACACGGTCTCCATCATACCAGAAAAATTACTCTTGAGCAGCGATTTTCCCGAGGACGCTCGTCAA
GCGGAGTCACTACTAGCAGACCTCGGTATCACTCATGTTCTTTCAATCTCACCCGCCGAGCTACCCCTCTCCGCT
CTCTCCGCCACCCTCAAATCTGAAAATCACCACTATCATATTAATGTGAGGAATAATGTAAAAGAAGACCTATTA
TTGGCGATGCCCGGCGCAATGCAGTTTGTAGAAGAAGCCATGGCTGATGGATTGGTGCTTGTACATTCACTTATG
GAGGTCCGTGCATGTACTATCGCTTGTGCTTGTTTGATGAAGCAGCGCAATCTTGCACCTGACGAAGCATACGCC
TTGATTGAGGATTCACTCCCGTTGTTCAATCCCACTGTCAAATTTTCCCGGAATCTTGAATTGTTCGACGCTTGT
GGCTATCAGCCTACAAGGGACCATTCAATTGTTCAGGAGTGGCTTTCCTCCAATGGTCCGGAAATCGGGAGTTCA
CAAAGCCCGGGTTTTTCGCCGGAGAGTTCTCGGCGCCCAAGTGGAAGCATCATCAAGTCAACGAGTTCCATTTCG
TTTCCCAAAGACCTGAGGTCGACTACCACGTCACGAGAAGCCGCTATCTCTTCCGGTTCTTCTGCTCCACCTTCG
TCATATCTCTCACAACCGATGCACAAAAGGCCCACTAGCTCTTCTAGAATGTGTAACCAGAATCATATGAGCCCC
CCTGATACGGATCTCGGAGCAAGAGCCAAGGACATTCTCAGTAATACTGGATTTGACTTGACAGAGTTCGCGGAT
GCGTTGAAGGAAATAGAGGGAAGACCCTGTACTAGCAGTAAGAAGCGCGGGAATGGAGTTCAGAAGGATGTTCAT
AGTCCGCAGAGAAAGCAGCGGGCTGCTCAATCTATGTATTGCTAG
Transcript >Agabi119p4|066490
ATGATGTCAGATGCTGCAGCCTCTAGCACGAGTGAGATACTCAAAAATCAACTATATCTCGGAAACGTTGCAGCA
GTTAAATGCCCCGACACCAGAAAGAAACTCGGAATAACTCATGTCGTCTCTGTGTGCCACGAATACTGTCCCGAG
AATGGGACATCGGATACCCATCTACATATCCCGGTACAAGACACAGAGTATGAAGACCTCCTAATATACCTGCCC
AAAACTACTCATTTTATTCAAAACGCATTGGAGGAGGGAGGAAGAGTGTTGGTTCATTGTGTAATGGGAGTGTCG
CGGAGTACTACTGTCGTCGCTGCGTTTCTGATGAAGCACAAGAAGATGGATGCTAGATCTGCTTTACGATACATA
AAGCAACGACGGCTACAAGCTCATCCAAATTATGGTTTCATCAAACAACTTGACACCTATTCCAAGTGTCAATTC
GATCCTTGTCCAACCAATCCTGTATACCGCTCTTGGAAGAAACGACAGGAGCAAGACGTTACTTCCTTCCTCAAC
CAGCTTGTTGACACGGTCTCCATCATACCAGAAAAATTACTCTTGAGCAGCGATTTTCCCGAGGACGCTCGTCAA
GCGGAGTCACTACTAGCAGACCTCGGTATCACTCATGTTCTTTCAATCTCACCCGCCGAGCTACCCCTCTCCGCT
CTCTCCGCCACCCTCAAATCTGAAAATCACCACTATCATATTAATGTGAGGAATAATGTAAAAGAAGACCTATTA
TTGGCGATGCCCGGCGCAATGCAGTTTGTAGAAGAAGCCATGGCTGATGGATTGGTGCTTGTACATTCACTTATG
GAGGTCCGTGCATGTACTATCGCTTGTGCTTGTTTGATGAAGCAGCGCAATCTTGCACCTGACGAAGCATACGCC
TTGATTGAGGATTCACTCCCGTTGTTCAATCCCACTGTCAAATTTTCCCGGAATCTTGAATTGTTCGACGCTTGT
GGCTATCAGCCTACAAGGGACCATTCAATTGTTCAGGAGTGGCTTTCCTCCAATGGTCCGGAAATCGGGAGTTCA
CAAAGCCCGGGTTTTTCGCCGGAGAGTTCTCGGCGCCCAAGTGGAAGCATCATCAAGTCAACGAGTTCCATTTCG
TTTCCCAAAGACCTGAGGTCGACTACCACGTCACGAGAAGCCGCTATCTCTTCCGGTTCTTCTGCTCCACCTTCG
TCATATCTCTCACAACCGATGCACAAAAGGCCCACTAGCTCTTCTAGAATGTGTAACCAGAATCATATGAGCCCC
CCTGATACGGATCTCGGAGCAAGAGCCAAGGACATTCTCAGTAATACTGGATTTGACTTGACAGAGTTCGCGGAT
GCGTTGAAGGAAATAGAGGGAAGACCCTGTACTAGCAGTAAGAAGCGCGGGAATGGAGTTCAGAAGGATGTTCAT
AGTCCGCAGAGAAAGCAGCGGGCTGCTCAATCTATGTATTGCTAG
Gene >Agabi119p4|066490
ATGATGTCAGATGCTGCAGCCTCTAGCACGAGTGAGATACTCAAAAATCAACTATATCTCGGAAAGTGAGCGCTT
TTTTACGTCTACGCAACTTGCCGTTCACTTATACCGAGAGTCTTCTGCCAGCGTTGCAGCAGTTAAATGCCCCGA
CACCAGAAAGAAACTCGGAATAACTCATGTCGTCTCTGTGTGCCACGAATACTGTCCCGAGAATGGGACATCGGA
TACCCATCTACATATCCCGGTACAAGACACAGAGTATGAAGACCTCCTAATATACCTGCCCAAAACTACTCATTT
TATTCAAAACGCATTGGAGGAGGGAGGAAGAGTGTTGGTTCATTGTGTAATGGGAGTGTCGCGGAGTACTACTGT
CGTCGCTGCGTTTCGTGAGTAGTATTTCTTTCGGCCCCAACTACTCTGGATCTCTGACAGGTTCCAAGTGATGAA
GCACAAGAAGATGGATGCTAGATCTGCTTTACGATACATAAAGCAACGTGAGTCCGTCATTTTGTTGGCGAGTCC
AATGTGGTACTAACATTATCCTCAGGACGGCTACAAGCTCATCCAAATTATGGTTTCATCAAACAACTTGACACC
TATTCCAAGTGTCAATTCGATCCTTGTCCAACCAATCCTGTATACCGCTCTTGGAAGAAACGACAGGAGCAAGAC
GTTACTTCCTTCCTCAACCAGCTTGTTGACACGGTCTCCATCATACCAGAAAAATTACTCTTGAGCAGGTACGTC
TTCCGTAATGGCAAATTTTCCTGCCAAAATGTCATGTGCTGTTTTCTGATACTATTTATTATCCTTCTGCCACTC
ACCGTACCTCTCGCATATCGTTCAATGATCCGCCCCCGTATTGTCTGGAATTAATAGCGATTTTCCCGAGGACGC
TCGTCAAGCGGAGTCACTACTAGCAGACCTCGGTATCACTCATGTTCTTTCAATCTCACCCGCCGAGCTACCCCT
CTCCGCTCTCTCCGCCACCCTCAAATCTGAAAATCACCACTATCATATTAATGTGAGGAATAATGTAAAAGAAGA
CCTATTATTGGCGATGCCCGGCGCAATGCAGTTTGTAGAAGAAGCCATGGCTGATGGATTGGTGCTTGTACATTC
ACTTATGGAGGTCCGTGCATGTACTATCGCTTGTGCTTGTTGTGCGTATCGCATTTCCTTGTGGATATGTTTGGC
CTATCATCAATTAATACTGATCATTCACAGTGATGAAGCAGCGCAATCTTGCACCTGACGAAGCATACGCCTTGA
TTGAGGATTCACTCCCGTTGTTCAATCCCACTGTCAAATTTTCCCGGAATCTTGAATTGTTCGACGCTTGTGGCT
ATCAGCCTACAAGGGACCATTCAATTGTTCAGGAGTGGCTTTCCTCCAATGGTCCGGAAATCGGGAGTTCACAAA
GCCCGGGTTTTTCGCCGGAGAGTTCTCGGCGCCCAAGTGGAAGCATCATCAAGTCAACGAGTTCCATTTCGTTTC
CCAAAGACCTGAGGTCGACTACCACGTCACGAGAAGCCGCTATCTCTTCCGGTTCTTCTGCTCCACCTTCGTCAT
ATCTCTCACAACCGATGCACAAAAGGCCCACTAGCTCTTCTAGAATGTGTAACCAGAATCATATGAGCCCCCCTG
ATACGGATCTCGGAGCAAGAGCCAAGGACATTCTCAGTAATACTGGATTTGACTTGACAGAGTTCGCGGATGCGT
TGAAGGAAATAGAGGGAAGACCCTGTACTAGCAGTAAGAAGCGCGGGAATGGAGTTCAGAAGGATGTTCATAGTC
CGCAGAGAAAGCAGCGGGCTGCTCAATCTATGTATTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail