Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|065390
Gene name
Locationscaffold_03b:1207233..1209226
Strand+
Gene length (bp)1993
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 2.6E-08 528 570
PF01565 FAD_binding_4 FAD binding domain 3.0E-07 127 245

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 3 581 6.0E-78
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 573 2.0E-77
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 265 570 6.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|065390
MRLKALLDFVILVSTWSKGDGKCRCIYNEPCWPTEQDFASLSSHLSQPLLRPVPPASACYPFHNPSGNCSDVQSH
RRDSIWRTDQPGAYENINFESHIFQNGSISACYLNTTFGIPCEQGNVPPVGVDARTVEDVKVAVKFAGQHNLRLV
VKNTGSGRNAFMIWTHHLKNITYTAEFIPEGGSRKDAVPGLTVGAGVQWYEAYTAAAQNNRFVVGGISATGSNGA
AGGWIMGGGHSVFSPKFGLGEFSTNALLRCIADWGCARVDNAVEFTIVKPNGDYAVVNSHHNQDLFWALRGGGPG
SWGVLISVTYKTHDLFPLVFSTLNVTFSTPDAATSIVTELVRLSPILSDLGWGGYGVFSNMSLFLEFPSPNASWA
DVKSTILPLFDLAMNASHDPDAVATTTPLANPYELLNPSDGTESQDDPEVGGLAELGSRLLSRNAAELRPEETAR
LLLSFDFVEVHFVAGGAVGRVEPDSVALNPGWRKAVALVRTAGSWEEGTSAKAINRIQQGLAQDVTALDHISPDS
ATYMNEASLHELDFKKSFFGNHYDKLKAIKRKYDPRSLFIVAEGIASDEWDDALTCPR*
Coding >Agabi119p4|065390
ATGAGACTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAAATGCCGCTGT
ATCTATAACGAACCTTGTTGGCCCACCGAACAAGACTTTGCTTCTCTCTCCTCCCATCTGTCCCAGCCGCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTTTTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTATCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGACGCTAGGACGGTGGAAGATGTTAAAGTTGCTGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTGGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATACCGCC
GAATTTATCCCAGAAGGCGGTTCGAGAAAAGATGCCGTGCCTGGCTTGACTGTGGGCGCCGGTGTTCAGTGGTAT
GAAGCCTACACTGCTGCTGCTCAGAACAACCGCTTTGTCGTTGGCGGTATATCTGCAACAGGGTCTAATGGAGCT
GCAGGCGGTTGGATCATGGGTGGTGGTCACAGCGTATTTTCTCCAAAATTTGGCCTAGGCGAGTTTAGCACAAAT
GCCTTACTTAGATGCATTGCCGACTGGGGTTGTGCAAGAGTGGACAACGCCGTCGAGTTTACTATTGTCAAACCG
AATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTCTTCTGGGCGCTGAGAGGCGGCGGCCCAGGT
TCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTATTCCCACTTGTCTTCTCTACTCTTAACGTC
ACCTTCTCTACTCCGGATGCTGCGACTAGCATCGTCACGGAGCTCGTCAGACTATCCCCCATACTTTCAGACTTG
GGCTGGGGAGGTTACGGAGTATTTTCGAATATGAGCCTCTTCCTGGAATTTCCGTCCCCAAATGCCTCGTGGGCA
GATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAATGCTTCCCACGACCCCGATGCTGTCGCTACC
ACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGACGGCACTGAAAGCCAGGATGATCCAGAGGTT
GGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCTGCCGAGCTGAGACCGGAGGAGACAGCACGG
CTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGTGGAGCTGTTGGGCGTGTTGAACCCGATTCC
GTTGCTCTTAATCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGTACGGCAGGAAGTTGGGAAGAAGGAACTTCA
GCCAAAGCCATTAACAGGATTCAGCAGGGTCTTGCACAAGATGTTACAGCCTTGGATCACATATCACCAGACTCA
GCAACATACATGAATGAGGCATCGTTGCATGAACTGGACTTCAAGAAATCATTCTTTGGTAACCATTATGACAAA
TTGAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATTGTCGCTGAAGGTATAGCATCTGATGAATGG
GATGATGCGTTGACGTGCCCCCGATGA
Transcript >Agabi119p4|065390
ATGAGACTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAAATGCCGCTGT
ATCTATAACGAACCTTGTTGGCCCACCGAACAAGACTTTGCTTCTCTCTCCTCCCATCTGTCCCAGCCGCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTTTTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTATCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGACGCTAGGACGGTGGAAGATGTTAAAGTTGCTGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTGGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATACCGCC
GAATTTATCCCAGAAGGCGGTTCGAGAAAAGATGCCGTGCCTGGCTTGACTGTGGGCGCCGGTGTTCAGTGGTAT
GAAGCCTACACTGCTGCTGCTCAGAACAACCGCTTTGTCGTTGGCGGTATATCTGCAACAGGGTCTAATGGAGCT
GCAGGCGGTTGGATCATGGGTGGTGGTCACAGCGTATTTTCTCCAAAATTTGGCCTAGGCGAGTTTAGCACAAAT
GCCTTACTTAGATGCATTGCCGACTGGGGTTGTGCAAGAGTGGACAACGCCGTCGAGTTTACTATTGTCAAACCG
AATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTCTTCTGGGCGCTGAGAGGCGGCGGCCCAGGT
TCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTATTCCCACTTGTCTTCTCTACTCTTAACGTC
ACCTTCTCTACTCCGGATGCTGCGACTAGCATCGTCACGGAGCTCGTCAGACTATCCCCCATACTTTCAGACTTG
GGCTGGGGAGGTTACGGAGTATTTTCGAATATGAGCCTCTTCCTGGAATTTCCGTCCCCAAATGCCTCGTGGGCA
GATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAATGCTTCCCACGACCCCGATGCTGTCGCTACC
ACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGACGGCACTGAAAGCCAGGATGATCCAGAGGTT
GGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCTGCCGAGCTGAGACCGGAGGAGACAGCACGG
CTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGTGGAGCTGTTGGGCGTGTTGAACCCGATTCC
GTTGCTCTTAATCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGTACGGCAGGAAGTTGGGAAGAAGGAACTTCA
GCCAAAGCCATTAACAGGATTCAGCAGGGTCTTGCACAAGATGTTACAGCCTTGGATCACATATCACCAGACTCA
GCAACATACATGAATGAGGCATCGTTGCATGAACTGGACTTCAAGAAATCATTCTTTGGTAACCATTATGACAAA
TTGAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATTGTCGCTGAAGGTATAGCATCTGATGAATGG
GATGATGCGTTGACGTGCCCCCGATGA
Gene >Agabi119p4|065390
ATGAGACTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAAATGCCGCTGT
ATCTATAACGAACCTTGTTGGCCCACCGAACAAGACTTTGCTTCTCTCTCCTCCCATCTGTCCCAGCCGCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTTTTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTATCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGACGCTAGGACGGTGGAAGATGTTAAAGTTGCTGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTGGTC
GTCAAGAATACAGGGTAAGCTCTTTTGGGATATCTTCACTAAAAGTTGTTGAACCATAGACTTTATAAATCCACA
GACATGATTATCTCGGCCGTAGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCT
ATACCGCCGAATTTATCCCAGAAGGCGGTTCGAGAAAAGATGCCGTGCCTGGTTCGTCTAAGTCTAGCTCTCATT
AGCCCTAAAGGTTGACCGTTCGACGATAAATAGGCTTGACTGTGGGCGCCGGTGTTCAGTGGTATGAAGCCTACA
CTGCTGCTGCTCAGAACAACCGCTTTGTCGTTGGCGGTATATCTGCAACAGGGTCTAATGGAGCTGCAGGCGGTT
GGATCATGGGTGGTGGTCACAGCGTATTTTCTCCAAAATTTGGCCTAGGCGAGTTTAGCACAAATGCCTTACTTA
GATGCATTGCCGACTGGGGTTGTGCAAGAGTGGACAACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATT
ATGCCGTAGTCAACTCTCACCATAATCAAGACCTCTTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAG
TCCTCATCTCTGTGACTTACAAAACGCACGATTTATTCCCACTTGTCTTCTCTACTCTTAACGTCACCTTCTCTA
CTCCGGATGCTGCGACTAGCATCGTCACGGAGCTCGTCAGACTATCCCCCATACTTTCAGACTTGGGCTGGGGAG
GTTACGGAGTATTTTCGAATATGAGCCTCTTCCTGGAATTTCCGTCCCCAAATGCCTCGTGGGCAGATGTCAAAT
CTACCATTCTTCCTCTCTTTGACCTCGCTATGAATGCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTC
TTGCTAACCCTTATGAGCTCCTGAATCCCAGTGACGGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGG
CCGAACTCGGGTCCCGGTTATTATCCCGCAACGCTGCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGA
GCTTTGATTTTGTTGAAGTTCAGTACGTAAAATTCATCCTAGTACAGAAATATCTAACTGACTTGTCATAGTTTC
GTCGCGGGTGGAGCTGTTGGGCGTGTTGAACCCGATTCCGTTGCTCTTAATCCAGGGTGGAGAAAAGCTGTAGCC
CTTGTACGTACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATTAACAGGATTCAGCAGGGTCTTGCA
CAAGATGTTACAGCCTTGGATCACATATCACCAGACTCAGCAACATACATGAATGAGGTAGAGTGTTTTTCAGAT
AGTAGTTCACGACGGTTTATAATTCTCATCACAGGCATCGTTGCATGAACTGGACTTCAAGAAATCATTCTTTGG
TAACCATTATGACAAATTGAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATTGTCGCTGAAGGTAT
AGCATCTGATGAATGGGATGATGCGTTGACGTGCCCCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail