Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|065350
Gene name
Locationscaffold_03b:1200373..1201723
Strand+
Gene length (bp)1350
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 9.8E-50 68 282

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 12 374 1.0E-168
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 48 280 2.0E-95
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 39 280 2.0E-20

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999676

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup267
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|027140
Agaricus bisporus var bisporus H39 AgabiH39|065350
Agaricus bisporus var bisporus H97 AgabiH97|027140
Agaricus bisporus var bisporus H97 AgabiH97|065350
Agaricus bisporus var burnettii H119p4 Agabi119p4|027140
Agaricus bisporus var burnettii H119p4 Agabi119p4|065350 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|065350
MFSLLNFITLGLACTWSVLAFPSTYTSLGGLPREELDRILPSLQYRSPGAPPGPLKFNGTKLVNDDQHPWKPLKH
GDMRGPCPGLNTLASHGYLPRNGIATPAQIINAVQEGFNMENSVARLVTYAAHLVDGNLITDKLSIGGKSPLTGP
SPPAPANAAGLNTHALFEGDVSMTRADAFFGDNHSFNETLFDEFTAFSNRFGAGKYNLTVAAEYRFHRIQESIAT
NPNFSFVSPRFFTAYAESVFPINFFIDGRQGDGQLDLDVARGFFQNMRMPDGFHRASMPTGLEGLAEIASVHPIS
PGANVNGVNTYTFDPSSADFTTFCLLYVNFVNQTVRSLYPEPTGNLKKALKKNLEFLYGPFSDQCSQVFPYGKDN
*
Coding >Agabi119p4|065350
ATGTTTAGCCTTCTCAATTTCATCACTCTAGGACTTGCTTGCACTTGGTCTGTTCTTGCTTTTCCTTCGACATAT
ACTTCATTGGGCGGTTTGCCCAGAGAAGAATTGGATAGAATATTGCCATCCCTCCAGTATCGCTCCCCGGGAGCT
CCTCCTGGCCCTCTGAAATTCAATGGCACTAAGCTCGTCAACGACGACCAACACCCATGGAAGCCTTTGAAACAT
GGTGACATGCGAGGGCCATGCCCAGGATTGAACACGCTTGCTTCGCATGGATATCTCCCTCGTAATGGTATTGCG
ACGCCTGCTCAAATCATCAACGCCGTTCAGGAAGGTTTTAACATGGAGAACAGTGTCGCGAGATTAGTAACCTAT
GCTGCCCATCTGGTTGATGGTAATCTCATCACAGACAAACTCAGCATCGGCGGAAAGAGTCCGTTGACTGGTCCT
AGCCCACCGGCCCCAGCTAATGCCGCAGGTTTGAATACGCATGCTCTGTTCGAGGGAGATGTAAGCATGACTCGA
GCGGATGCCTTCTTTGGTGACAACCACAGCTTCAACGAGACACTATTTGACGAGTTTACTGCCTTCAGCAACCGA
TTCGGTGCCGGAAAATACAACCTTACGGTCGCTGCGGAGTACCGATTTCATCGGATTCAAGAATCTATCGCGACA
AATCCCAACTTTTCCTTCGTGTCCCCTCGGTTTTTCACTGCTTATGCCGAGTCCGTGTTCCCCATCAATTTTTTC
ATAGATGGGCGTCAGGGAGATGGCCAATTGGATCTTGACGTTGCTCGTGGCTTCTTCCAGAACATGCGGATGCCG
GATGGATTCCATAGGGCCAGTATGCCGACGGGGCTTGAGGGTCTCGCCGAAATCGCTAGCGTTCACCCCATTTCC
CCCGGTGCCAATGTCAACGGGGTCAATACTTATACTTTTGATCCCAGCTCCGCTGACTTCACAACCTTCTGTCTG
TTGTACGTGAATTTTGTAAACCAGACCGTGCGCAGTCTCTACCCAGAACCAACTGGTAATTTAAAGAAGGCGCTC
AAAAAGAATTTGGAATTCTTATATGGCCCATTCAGCGATCAATGTTCCCAAGTCTTTCCTTATGGAAAGGACAAT
TGA
Transcript >Agabi119p4|065350
ATGTTTAGCCTTCTCAATTTCATCACTCTAGGACTTGCTTGCACTTGGTCTGTTCTTGCTTTTCCTTCGACATAT
ACTTCATTGGGCGGTTTGCCCAGAGAAGAATTGGATAGAATATTGCCATCCCTCCAGTATCGCTCCCCGGGAGCT
CCTCCTGGCCCTCTGAAATTCAATGGCACTAAGCTCGTCAACGACGACCAACACCCATGGAAGCCTTTGAAACAT
GGTGACATGCGAGGGCCATGCCCAGGATTGAACACGCTTGCTTCGCATGGATATCTCCCTCGTAATGGTATTGCG
ACGCCTGCTCAAATCATCAACGCCGTTCAGGAAGGTTTTAACATGGAGAACAGTGTCGCGAGATTAGTAACCTAT
GCTGCCCATCTGGTTGATGGTAATCTCATCACAGACAAACTCAGCATCGGCGGAAAGAGTCCGTTGACTGGTCCT
AGCCCACCGGCCCCAGCTAATGCCGCAGGTTTGAATACGCATGCTCTGTTCGAGGGAGATGTAAGCATGACTCGA
GCGGATGCCTTCTTTGGTGACAACCACAGCTTCAACGAGACACTATTTGACGAGTTTACTGCCTTCAGCAACCGA
TTCGGTGCCGGAAAATACAACCTTACGGTCGCTGCGGAGTACCGATTTCATCGGATTCAAGAATCTATCGCGACA
AATCCCAACTTTTCCTTCGTGTCCCCTCGGTTTTTCACTGCTTATGCCGAGTCCGTGTTCCCCATCAATTTTTTC
ATAGATGGGCGTCAGGGAGATGGCCAATTGGATCTTGACGTTGCTCGTGGCTTCTTCCAGAACATGCGGATGCCG
GATGGATTCCATAGGGCCAGTATGCCGACGGGGCTTGAGGGTCTCGCCGAAATCGCTAGCGTTCACCCCATTTCC
CCCGGTGCCAATGTCAACGGGGTCAATACTTATACTTTTGATCCCAGCTCCGCTGACTTCACAACCTTCTGTCTG
TTGTACGTGAATTTTGTAAACCAGACCGTGCGCAGTCTCTACCCAGAACCAACTGGTAATTTAAAGAAGGCGCTC
AAAAAGAATTTGGAATTCTTATATGGCCCATTCAGCGATCAATGTTCCCAAGTCTTTCCTTATGGAAAGGACAAT
TGA
Gene >Agabi119p4|065350
ATGTTTAGCCTTCTCAATTTCATCACTCTAGGACTTGCTTGCACTTGGTCTGTTCTTGCTTTTCCTTCGACATAT
ACTTCATTGGGCGGTTTGCCCAGAGAAGAATTGGATAGAATATTGCCATCCCTCCAGTATCGCTCCCCGGGAGCT
CCTCCTGGCCCTCTGAAATTCAATGGCACTAAGCTCGTCAACGACGACCAACACCCATGGAAGCCTTTGAAACAT
GGTGACATGCGAGGGCCATGCCCAGGATTGAACACGCTTGCTTCGCATGGAGTTCGTTTTTCATGTTTGAAGCCG
TTGAATATATTTAGTCTAACCATTGTTCTCAGTATCTCCCTCGTAATGGTATTGCGACGCCTGCTCAAATCATCA
ACGCCGTTCAGGAAGGTGTGTAATATATAATTCAAATATATATCTTATCCCCATAAATTAACATCCTCACTAGGT
TTTAACATGGAGAACAGTGTCGCGAGATTAGTAACCTATGCTGCCCATCTGGTTGATGGTAATCTCATCACAGAC
AAACTCAGCATCGGCGGAAAGAGTCCGTTGACTGGTCCTAGCCCACCGGCCCCAGCTAATGCCGCAGGTTTGAAT
ACGCATGCTCTGTTCGAGGGAGATGTAAGCATGACTCGAGGTCCGTTGCGCGAACTATGCCACATGTTGAACAGC
ATTCTCATCGTCATTCATACTCAGCGGATGCCTTCTTTGGTGACAACCACAGCTTCAACGAGACACTATTTGACG
AGGCGGGTCTTTTCTAATTTCGTAGTTTCACCATCACTGACGACTTTACAGTTTACTGCCTTCAGCAACCGATTC
GGTGCCGGAAAATACAACCTTACGGTCGCTGCGGAGTACCGATTTCATCGGATTCAAGAATCTATCGCGACAAAT
CCCAACTTTTCCTTCGTGTCCCCTCGGTTTTTCACTGCTTATGCCGAGTCCGTGTTCCCCATCAATTTTTTCATA
GATGGGCGTCAGGGAGATGGCCAATTGGATCTTGACGTTGCTCGTGGCTTCTTCCAGAACATGCGGATGCCGGAT
GGATTCCATAGGGCCAGTATGCCGACGGGGCTTGAGGGTCTCGCCGAAATCGCTAGCGTTCACCCCATTTCCCCC
GGTGCCAATGTCAACGGGGTCAATACTTATACTTTTGATCCCAGCTCCGCTGACTTCACAACCTTCTGTCTGTTG
TACGTGAATTTTGTAAACCAGACCGTGCGCAGTCTCTACCCAGAACCAACTGGTAATTTAAAGAAGGCGCTCAAA
AAGAATTTGGAATTCTTATATGGCCCATTCAGCGATCAATGTTCCCAAGTCTTTCCTTATGGAAAGGACAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail