Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|064680
Gene name
Locationscaffold_03b:1020834..1024416
Strand-
Gene length (bp)3582
Transcript length (bp)2781
Coding sequence length (bp)2781
Protein length (aa) 927

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 4.4E-154 289 800
PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase 6.0E-37 88 199
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 2.3E-13 202 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 70 876 0.0E+00
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 73 899 0.0E+00
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 78 898 0.0E+00
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 105 843 0.0E+00
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 48 856 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 70 876 0.0E+00
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 73 899 0.0E+00
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 78 898 0.0E+00
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 105 843 0.0E+00
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 48 856 0.0E+00
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 57 867 0.0E+00
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 73 867 0.0E+00
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 71 917 0.0E+00
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 73 867 0.0E+00
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 72 926 0.0E+00
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 73 899 0.0E+00
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 73 899 0.0E+00
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 75 839 1.0E-172
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 66 903 2.0E-170
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 35 842 7.0E-167
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 100 902 2.0E-166
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 75 905 3.0E-166
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 17 920 6.0E-163
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 66 911 7.0E-163
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 74 926 2.0E-158
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 74 926 1.0E-157
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 72 926 1.0E-155
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 102 926 5.0E-154
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 102 926 1.0E-153
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 66 909 1.0E-152
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 74 926 3.0E-147
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 72 896 6.0E-144
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 75 846 2.0E-135
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 75 926 2.0E-135
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 101 926 2.0E-132
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 75 912 4.0E-124
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 76 913 8.0E-122
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 101 926 2.0E-120
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 76 926 2.0E-119
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 76 843 6.0E-119
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 71 843 3.0E-115
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 75 926 3.0E-113
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 85 926 1.0E-110
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 88 859 2.0E-104
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 119 830 2.0E-87
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 189 888 1.0E-82
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 144 842 1.0E-79
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 95 477 2.0E-74
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 175 909 1.0E-72
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 203 888 4.0E-72
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 175 925 8.0E-72
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 175 909 2.0E-71
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 175 909 8.0E-71
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 238 896 3.0E-70
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 73 482 9.0E-68
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 190 888 1.0E-67
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 201 911 5.0E-65
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 189 918 1.0E-64
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 189 868 6.0E-64
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 540 925 2.0E-61
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 506 926 6.0E-52
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 163 819 5.0E-47
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 163 819 6.0E-47
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 546 854 1.0E-43
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 143 843 4.0E-28
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 562 840 6.0E-24
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 286 839 3.0E-21
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 534 760 3.0E-15
sp|P32138|YIHQ_ECOLI Alpha-glucosidase YihQ OS=Escherichia coli (strain K12) GN=yihQ PE=1 SV=3 637 781 9.0E-10
sp|P19965|SP15_TORCA SITS-binding protein OS=Torpedo californica PE=1 SV=2 636 795 2.0E-09
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 549 802 6.0E-09
sp|A2QTU5|XYLA_ASPNC Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axlA PE=1 SV=1 605 761 2.0E-08
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 179 497 1.0E-06
sp|Q6NSJ0|K1161_HUMAN Uncharacterized family 31 glucosidase KIAA1161 OS=Homo sapiens GN=KIAA1161 PE=1 SV=2 628 760 2.0E-06
sp|Q69ZQ1|K1161_MOUSE Uncharacterized family 31 glucosidase KIAA1161 OS=Mus musculus GN=Kiaa1161 PE=1 SV=2 650 789 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|064680
MTRVSDYLNGGGFELDLCFSIVHSALSTLFVLAPKYLLPGASLNLHWIFLTLWLRLVSYVFATNVDPAVLDACPG
YNAQNVKMEGGTLTADLTLADEACNVFGEDLTTLSLRVDYETKDRIHLKIVDPNSSRYEIPESVLPRPSNQAVSP
DSASIQFNFTTSPFTFSIYRSSSQEILFSTASHPIIFEPQYLRVKTNLPDNANIYGFGEHTNPFHLSTANTTLTL
WSRDSPGIPAGRNLYGNHPVYFEHRTTGTHGVFFLNSNGMDIKLSNTGGTSLEYNAIGGVMDFYFLSGSESDPAA
VARQYAEVVGLPAEVAYWTFGLHQCRFGYKDFVDVAGVVSKYAAAGIPLETMWTDIDYMDRRRIFTVDPQYFPMN
RMREIVDHLHSNDQRYIVMTDPAVAFLPDDPSYLSYHRGKDLNVYLKAENGSDFIAIVWPGVTVYPDWFSPNVTE
YWNNEFREFYDPETGLDIDGAWIDMNEPSNFCNLPCDDPFQQARDANLPPPRSSQPPDPNAPIFQNDSRPQLRKR
DDILDPPYAIDNDAGALSSRTAMTNATHANGLQEYDTHNLYGSMMSIATRTAMLARRPGKRTLVITRSTFAGVGA
HVGKWLGDNLSRWDQYRFSIAGMLNFATIFQVPMVGSDICGFNEDTSETLCARWAMLGAFYPFMRNHNADNAKSQ
EYYIWPLVTQAAKNAIDIRYRLMDYFYTAFHQAHTDGTPVLHPLWFKYPKDANTFPLDLQFFFGDSILVSPVTEE
GSTSVDIYLPDDIFYNFTSLAPIEGTGSTVSLSNVDFTTIPVHIKGGVVLPLRVESAMTTTELRTKDFEFVVATG
QDGTASGSLYIDDGESIEPSQMTTVDMSFKEGKLDVKGTFDFPTGVNVARVRFLNVENAPSAVKVNGEEVDSSRF
EHDATNKVLDVSVGVSLDKGLSVEFS*
Coding >Agabi119p4|064680
ATGACTCGAGTGAGTGACTACCTCAACGGGGGCGGATTTGAACTTGATTTGTGTTTCAGCATTGTACATTCAGCA
CTCAGCACACTATTCGTGTTGGCACCAAAATACCTCTTACCTGGTGCTAGTTTAAATCTGCACTGGATATTCCTC
ACACTGTGGTTGAGGTTGGTTTCCTATGTCTTTGCTACCAACGTCGATCCGGCAGTTTTGGATGCATGCCCTGGG
TACAACGCGCAGAACGTCAAGATGGAAGGAGGAACCCTTACAGCGGATCTTACACTTGCGGATGAAGCTTGCAAC
GTCTTCGGAGAGGACCTTACAACGCTTTCTCTGAGAGTTGATTATGAGACGAAGGATCGTATCCACTTGAAGATA
GTCGATCCCAACTCGAGCCGCTATGAAATTCCCGAGAGTGTCTTACCTAGACCCTCCAACCAAGCAGTGTCGCCA
GACTCGGCTTCAATCCAATTCAACTTCACCACCTCACCGTTCACTTTCTCAATCTATCGGAGTTCCTCTCAGGAG
ATACTCTTCTCTACTGCTTCGCATCCCATCATATTCGAGCCGCAATATCTTCGCGTGAAGACAAATCTACCTGAC
AATGCGAACATATATGGTTTCGGGGAGCACACTAATCCCTTTCATCTCTCAACCGCCAATACGACACTTACTTTA
TGGTCTCGCGATTCCCCCGGGATTCCGGCTGGTAGAAATTTATATGGAAATCACCCCGTCTATTTCGAACATCGT
ACCACGGGAACACATGGTGTCTTTTTCTTAAATTCCAATGGCATGGATATCAAGCTCAGCAACACGGGAGGAACC
AGTCTGGAGTATAACGCCATCGGTGGTGTTATGGACTTTTACTTCTTGTCTGGCAGTGAGTCGGATCCGGCAGCA
GTCGCGAGGCAATATGCGGAAGTCGTCGGTCTCCCAGCTGAGGTAGCATATTGGACTTTCGGCCTTCATCAATGT
CGCTTTGGCTATAAAGATTTCGTCGACGTGGCTGGAGTTGTTTCTAAGTATGCAGCAGCTGGCATACCCCTGGAG
ACTATGTGGACGGATATCGATTACATGGATAGGCGTCGGATTTTCACTGTCGACCCGCAATACTTCCCGATGAAC
CGGATGCGCGAAATCGTCGACCATTTGCATTCCAATGATCAGCGCTATATTGTGATGACTGATCCCGCGGTAGCG
TTTCTACCTGACGATCCGAGTTACCTGTCATATCACCGTGGCAAAGACCTCAATGTGTATTTGAAAGCTGAAAAC
GGAAGTGATTTCATTGCAATCGTTTGGCCCGGCGTGACTGTATATCCGGATTGGTTTAGTCCCAACGTCACAGAA
TATTGGAACAACGAGTTCCGAGAATTCTATGATCCTGAAACGGGGCTCGATATTGATGGCGCATGGATCGATATG
AACGAACCATCTAATTTTTGCAACCTACCCTGTGACGATCCTTTCCAGCAAGCCAGAGATGCGAATCTCCCCCCG
CCCAGGTCAAGCCAACCCCCTGATCCCAATGCCCCTATCTTCCAGAATGATTCTCGGCCTCAACTAAGGAAGCGC
GATGACATCCTCGATCCACCGTATGCAATTGATAATGACGCGGGTGCGCTTTCGTCTAGGACCGCTATGACAAAT
GCGACTCATGCCAATGGACTGCAGGAGTACGACACTCACAATCTCTATGGGTCTATGATGTCTATTGCTACACGT
ACAGCCATGCTCGCTCGCCGTCCTGGGAAACGTACCCTCGTTATTACTCGTTCTACATTCGCTGGAGTCGGCGCA
CATGTTGGCAAGTGGCTTGGGGATAACCTTAGCAGATGGGATCAGTATAGGTTTTCAATCGCTGGTATGTTAAAT
TTTGCGACCATCTTCCAAGTCCCGATGGTTGGGAGCGACATTTGTGGATTTAATGAAGATACATCGGAAACTCTA
TGTGCTCGATGGGCCATGCTTGGCGCTTTCTATCCTTTCATGCGCAATCACAACGCGGACAACGCTAAAAGTCAA
GAGTATTACATCTGGCCTCTGGTAACTCAGGCAGCCAAAAACGCAATTGACATTCGTTATCGCCTCATGGACTAT
TTCTACACTGCTTTCCATCAAGCCCACACCGATGGCACGCCCGTTCTCCATCCTCTCTGGTTCAAATATCCGAAA
GACGCGAACACCTTCCCTCTTGATCTCCAATTCTTCTTCGGCGATTCAATTCTTGTCTCTCCCGTCACGGAAGAG
GGCTCGACCTCTGTTGACATATACCTTCCCGACGATATTTTCTACAACTTCACTTCCTTGGCTCCCATTGAGGGT
ACCGGATCAACTGTCTCTCTCTCCAACGTAGATTTCACGACTATCCCCGTTCACATCAAGGGTGGTGTCGTGCTT
CCCCTCCGCGTGGAATCTGCCATGACGACGACAGAGTTGAGGACGAAGGACTTTGAGTTCGTCGTAGCTACTGGT
CAAGATGGTACTGCCTCCGGCAGTCTATACATCGATGATGGAGAATCTATTGAGCCATCCCAAATGACTACTGTG
GATATGAGTTTCAAGGAGGGCAAGTTGGATGTAAAGGGAACATTTGATTTCCCAACCGGCGTCAATGTAGCGCGT
GTGCGGTTCCTTAACGTGGAGAACGCTCCAAGTGCGGTCAAAGTCAATGGGGAGGAAGTGGATAGTTCTCGTTTC
GAGCATGATGCGACGAACAAGGTGTTAGACGTCAGTGTTGGCGTTTCCCTTGACAAAGGTTTATCAGTGGAATTT
TCATAA
Transcript >Agabi119p4|064680
ATGACTCGAGTGAGTGACTACCTCAACGGGGGCGGATTTGAACTTGATTTGTGTTTCAGCATTGTACATTCAGCA
CTCAGCACACTATTCGTGTTGGCACCAAAATACCTCTTACCTGGTGCTAGTTTAAATCTGCACTGGATATTCCTC
ACACTGTGGTTGAGGTTGGTTTCCTATGTCTTTGCTACCAACGTCGATCCGGCAGTTTTGGATGCATGCCCTGGG
TACAACGCGCAGAACGTCAAGATGGAAGGAGGAACCCTTACAGCGGATCTTACACTTGCGGATGAAGCTTGCAAC
GTCTTCGGAGAGGACCTTACAACGCTTTCTCTGAGAGTTGATTATGAGACGAAGGATCGTATCCACTTGAAGATA
GTCGATCCCAACTCGAGCCGCTATGAAATTCCCGAGAGTGTCTTACCTAGACCCTCCAACCAAGCAGTGTCGCCA
GACTCGGCTTCAATCCAATTCAACTTCACCACCTCACCGTTCACTTTCTCAATCTATCGGAGTTCCTCTCAGGAG
ATACTCTTCTCTACTGCTTCGCATCCCATCATATTCGAGCCGCAATATCTTCGCGTGAAGACAAATCTACCTGAC
AATGCGAACATATATGGTTTCGGGGAGCACACTAATCCCTTTCATCTCTCAACCGCCAATACGACACTTACTTTA
TGGTCTCGCGATTCCCCCGGGATTCCGGCTGGTAGAAATTTATATGGAAATCACCCCGTCTATTTCGAACATCGT
ACCACGGGAACACATGGTGTCTTTTTCTTAAATTCCAATGGCATGGATATCAAGCTCAGCAACACGGGAGGAACC
AGTCTGGAGTATAACGCCATCGGTGGTGTTATGGACTTTTACTTCTTGTCTGGCAGTGAGTCGGATCCGGCAGCA
GTCGCGAGGCAATATGCGGAAGTCGTCGGTCTCCCAGCTGAGGTAGCATATTGGACTTTCGGCCTTCATCAATGT
CGCTTTGGCTATAAAGATTTCGTCGACGTGGCTGGAGTTGTTTCTAAGTATGCAGCAGCTGGCATACCCCTGGAG
ACTATGTGGACGGATATCGATTACATGGATAGGCGTCGGATTTTCACTGTCGACCCGCAATACTTCCCGATGAAC
CGGATGCGCGAAATCGTCGACCATTTGCATTCCAATGATCAGCGCTATATTGTGATGACTGATCCCGCGGTAGCG
TTTCTACCTGACGATCCGAGTTACCTGTCATATCACCGTGGCAAAGACCTCAATGTGTATTTGAAAGCTGAAAAC
GGAAGTGATTTCATTGCAATCGTTTGGCCCGGCGTGACTGTATATCCGGATTGGTTTAGTCCCAACGTCACAGAA
TATTGGAACAACGAGTTCCGAGAATTCTATGATCCTGAAACGGGGCTCGATATTGATGGCGCATGGATCGATATG
AACGAACCATCTAATTTTTGCAACCTACCCTGTGACGATCCTTTCCAGCAAGCCAGAGATGCGAATCTCCCCCCG
CCCAGGTCAAGCCAACCCCCTGATCCCAATGCCCCTATCTTCCAGAATGATTCTCGGCCTCAACTAAGGAAGCGC
GATGACATCCTCGATCCACCGTATGCAATTGATAATGACGCGGGTGCGCTTTCGTCTAGGACCGCTATGACAAAT
GCGACTCATGCCAATGGACTGCAGGAGTACGACACTCACAATCTCTATGGGTCTATGATGTCTATTGCTACACGT
ACAGCCATGCTCGCTCGCCGTCCTGGGAAACGTACCCTCGTTATTACTCGTTCTACATTCGCTGGAGTCGGCGCA
CATGTTGGCAAGTGGCTTGGGGATAACCTTAGCAGATGGGATCAGTATAGGTTTTCAATCGCTGGTATGTTAAAT
TTTGCGACCATCTTCCAAGTCCCGATGGTTGGGAGCGACATTTGTGGATTTAATGAAGATACATCGGAAACTCTA
TGTGCTCGATGGGCCATGCTTGGCGCTTTCTATCCTTTCATGCGCAATCACAACGCGGACAACGCTAAAAGTCAA
GAGTATTACATCTGGCCTCTGGTAACTCAGGCAGCCAAAAACGCAATTGACATTCGTTATCGCCTCATGGACTAT
TTCTACACTGCTTTCCATCAAGCCCACACCGATGGCACGCCCGTTCTCCATCCTCTCTGGTTCAAATATCCGAAA
GACGCGAACACCTTCCCTCTTGATCTCCAATTCTTCTTCGGCGATTCAATTCTTGTCTCTCCCGTCACGGAAGAG
GGCTCGACCTCTGTTGACATATACCTTCCCGACGATATTTTCTACAACTTCACTTCCTTGGCTCCCATTGAGGGT
ACCGGATCAACTGTCTCTCTCTCCAACGTAGATTTCACGACTATCCCCGTTCACATCAAGGGTGGTGTCGTGCTT
CCCCTCCGCGTGGAATCTGCCATGACGACGACAGAGTTGAGGACGAAGGACTTTGAGTTCGTCGTAGCTACTGGT
CAAGATGGTACTGCCTCCGGCAGTCTATACATCGATGATGGAGAATCTATTGAGCCATCCCAAATGACTACTGTG
GATATGAGTTTCAAGGAGGGCAAGTTGGATGTAAAGGGAACATTTGATTTCCCAACCGGCGTCAATGTAGCGCGT
GTGCGGTTCCTTAACGTGGAGAACGCTCCAAGTGCGGTCAAAGTCAATGGGGAGGAAGTGGATAGTTCTCGTTTC
GAGCATGATGCGACGAACAAGGTGTTAGACGTCAGTGTTGGCGTTTCCCTTGACAAAGGTTTATCAGTGGAATTT
TCATAA
Gene >Agabi119p4|064680
ATGACTCGAGTGAGTGACTACCTCAACGGGGGCGGATTTGAACTTGATTTGTGTTTCAGCATTGTACATTCAGCA
CTCAGCACACTATTCGTGTTGGCACCAAAATACCTCTTGTTCGCATTCAGCGTTCGACAATTACCTTTGGCTCCG
GGATTTTCACAGACCTGGTGCTAGTGTGTGCAAACGGTGAAATGTTCCACGCGGTCGCCTCAATGATACACGAGG
TTTAAATCTGTGAGGTCTCTCGATTCGTTCAACGACTACCTTTTTTCACCATGGCCTTCCTTGGCTCATACAGGC
ACTGGATATTCCTCACACTGTGGTTGAGGTTGGTTTCCTATGTCTTTGCTACCAACGTCGATCCGGCAGTTTTGG
ATGCATGCCCTGGGTACAACGCGCAGAACGTCAAGATGGAAGGAGGAACCCTTACAGCGGATCTTACACTTGCGG
ATGAAGCTTGCAACGTCTTCGGAGAGGACCTTACAACGCTTTCTCTGAGAGTTGATTATGAGACGAGTAATCCTT
CATCCTATAGTAGTCCGGACAACGCTGATAATTGCTGTAGAGGATCGTATCCACTTGAAGATAGTCGATCCCAAC
TCGAGCCGCTATGAAATTCCCGAGAGTGTCTTACCTAGACCCTCCAACCAAGCAGTGTCGCCAGACTCGGCTTCA
ATCCAATTCAACTTCACCACCTCACCGTTCACTTTCTCAATCTATCGGAGTTCCTCTCAGGAGATACTCTTCTCT
ACTGCTTCGCATCCCATCATATTCGAGCCGCAATATCTTCGCGTGAAGACAAATCTACCTGACAATGCGAACATA
TATGGTTTCGGGGAGCACACTAATCCCTTTCATCTCTCAACCGCCAATACGACACTTACTTTATGGTCTCGCGAT
TCCCCCGGGATTCCGGCTGGTAGAAATTTATATGGAAATCACCCCGTCTATTTCGAACATCGTACCACGGGAACA
CATGGTGTCTTTTTCTTAAATTCCAATGGCATGGATATCAAGCTCAGCAACACGGGAGGAACCAGTCTGGAGTAT
AACGCCATCGGTGGTGTTATGGACTTTTACTTCTTGTCTGGCAGTGAGTCGGATCCGGCAGCAGTCGCGAGGCAA
TATGCGGAAGTCGTCGGTCTCCCAGCTGAGGTAGCATATTGGACTTTCGGCCTTCATCAATGTCGCTTTGGCTAT
AAAGGTATATAATTCTTATCTTTCATCACTTCGATAAATTGACTCAATAAATGCAGATTTCGTCGACGTGGCTGG
AGTTGTTTCTAAGTATGCAGCAGCTGGCATACCCCTGGAGACTATGTGGACGGATATCGGTATAGTTGTCCTCCC
GTTCTCTTCAGGACAGAATCTTCAACTACGGGAACAGATTACATGGATAGGCGTCGGATTTTCACTGTCGACCCG
CAATACTTCCCGATGAACCGGATGCGCGAAATCGTCGACCATTTGCATTCCAATGATCAGCGCTATAGTGAGTCC
TGACTCAGCCCTCTTCACCATCCTTTTCATTAACGTCGCTCCAACCAGTTGTGATGACTGATCCCGCGGTAGCGT
TTCTACCTGACGATCCGAGTTACCTGTCATATCACCGTGGCAAAGACCTCAATGTGTATTTGAAAGCTGAAAACG
GAAGTGATTTCATTGCAATCGTTTGGCCCGGTAAGCATCTTCGTCACTTGCAAATTGGAAGAGGTTATTGATATG
CTAGGAATAAGGCGTGACTGTATATCCGGGTAAATCGATATTACCAGCTTTTCGTTGCTCGTTCCTGACATAACC
TCCAGATTGGTTTAGTCCCAACGTCACAGAGTATGTGTAAATCTTTTTTTCGATGGTGAATCTAACACTCATCAA
GATATTGGAACAACGAGTTCCGAGAATTCTATGATCCTGAAACGGGGCTCGATATTGATGGCGCATGGATCGATA
TGAACGAACCATCTAATGTAAGTGAAATATTTGCAGGTCTCATTATTTCGTTGAAGTGATCTTCGTCACGTTTCC
TCCAGTTTTGCAACCTACCCTGTGACGATCCTTTCCAGCAAGCCAGAGATGCGAATCTCCCCCCGCCCAGGTCAA
GCCAACCCCCTGATCCCAATGCCCCTATCTTCCAGAATGATTCTCGGCCTCAACTAAGGAAGCGCGATGACATCC
TCGATCCACCGTATGCAATTGATAATGACGCGGGTGCGCTTTCGTCTAGGACCGCTATGGTGGGTATTCAATCAA
TGTTTTCGTGTAATGAACTTTTCTCATCTCAATTCGTTTCTAGACAAATGCGACTCATGCCAATGGACTGCAGGA
GTACGACACTCACAATCTCTATGGGTCTATGATGTCTATTGCTACACGTACAGCCATGCTCGCTCGCCGTCCTGG
GAAACGTACCCTCGTTATTACTCGTTCTACATTCGCTGGAGTCGGCGCACATGTTGGCAAGTGGCTTGGGGATAA
CCTTAGCAGATGGGATCAGTATAGGTTTTCAATCGCTGGTATGTTAAATTTTGCGACCATCTTCCAAGTCCCGAT
GGTTGGGAGCGACATTTGTGGATTTAGTGAGTTCAATCTATACTGTGTTTCTTGATGACTTATTGGGTTCCCTGA
TAGATGAAGATACATCGGAAACTCTATGTGCTCGATGGGCCATGCTTGGCGCTTTCTATCCTTTCATGCGCAATG
TATGTCATTTGCCTTTCTAACCTTTGAGTTACCTTGACAAGATATGCAGCACAACGCGGACAACGCTAAAAGTCA
AGAGTATTACATCTGGCCTCTGGTAACTCAGGCAGCCAAAAACGCAATTGACATTCGGTCTGTTGTTTTCAATAT
TTTGACACCTAAGGTACTAACGCTGTTTATAGTTATCGCCTCATGGACTATTTCTACACTGCTTTCCATCAAGCC
CACACCGATGGCACGCCCGTTCTCCATCCTCTCTGGTTCAAATATCCGAAAGACGCGAACACCTTCCCTCTTGAT
CTCCAATTCTTCTTCGGCGATTCAATTCTTGTCTCTCCCGTCACGGAAGAGGGCTCGACCTCTGTTGACATATAC
CTTCCCGACGATATTTTCTACAACTTCACTTCCTTGGCTCCCATTGAGGGTACCGGATCAACTGTCTCTCTCTCC
AACGTAGATTTCACGACTATCCCCGTTCACATCAAGGGTGGTGTCGTGCTTCCCCTCCGCGTGGAATCTGCCATG
ACGACGACAGAGTTGAGGACGAAGGACTTTGAGTTCGTCGTAGCTACTGGTCAAGATGGTACTGCCTCCGGCAGT
CTATACATCGATGATGGAGAATCTATTGAGCCATCCCAAATGACTACTGTGGATATGAGTTTCAAGGAGGGCAAG
TTGGATGTAAAGGGAACATTTGATTTCCCAACCGGCGTCAATGTAGCGCGTGTGCGGTTCCTTAACGTGGAGAAC
GCTCCAAGTGCGGTCAAAGTCAATGGGGAGGAAGTGGATAGTTCTCGTTTCGAGCATGATGCGACGAACAAGGTG
TTAGACGTCAGTGTTGGCGTTTCCCTTGACAAAGGTTTATCAGTGGAATTTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail