Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|064660
Gene name
Locationscaffold_03b:1013129..1014770
Strand-
Gene length (bp)1641
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20179 MSS51_C MSS51 C-terminal domain 4.1E-35 220 433
PF01753 zf-MYND MYND finger 3.1E-07 37 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8C0R7|ZMY15_MOUSE Zinc finger MYND domain-containing protein 15 OS=Mus musculus GN=Zmynd15 PE=1 SV=1 33 376 1.0E-18
sp|Q9H091|ZMY15_HUMAN Zinc finger MYND domain-containing protein 15 OS=Homo sapiens GN=ZMYND15 PE=2 SV=2 36 378 1.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|064660
MAPAALDSSVFFDPSDLNDIDAILHYDDDPKHSTHVCLNCRRVETPDHKLVPCAQCKSVFYCDVVCSNENWLKGR
RGSLRHRDVCRFLRRSHKKRPAMQAIARQFPWMRQTYDGSYTCDRYRDSRGLFGCGTNYGWWTTPPCSCDDDVDY
ISGMQLLEDEPKEERQGWLLPDDEIPWLDFESMDIAPPTAPPNFEHNWTSYYEWRGLPLRSPAALLLHWPLSTYR
LLCQLNCIPSDIPMQRRRLTVHLLGVTRELDLLPLFGELALLIPNTDIELVMFGSGVFRVLMEAENDEDCIASQP
YAYTYTAPDASGGSTIKISLSDAGPIWGDQEIHIPSKRPDAMIALDANFDGCGQWQLALLASRAYNIPFAVTESQ
EVNIDFSMSALRELPAARKTMWAWVDLNEEEEKRIRKTATKTYTWGLNPFMCPGPKPQALGGGPMASNGFEFIIT
TGGADEDADPVKLKKRGPLLDDYM*
Coding >Agabi119p4|064660
ATGGCCCCCGCCGCCCTCGACTCTTCTGTCTTCTTCGACCCTAGCGACCTCAACGACATCGATGCCATCTTGCAT
TACGACGATGATCCAAAGCATTCGACGCATGTCTGTTTGAATTGCCGTCGAGTGGAGACCCCTGACCACAAACTC
GTTCCTTGTGCTCAGTGTAAATCCGTCTTTTATTGTGATGTCGTCTGTTCCAACGAGAATTGGCTGAAGGGCAGG
AGAGGCTCACTCCGCCACAGGGATGTTTGTAGGTTCTTGAGACGCAGCCACAAAAAGCGTCCAGCAATGCAGGCC
ATTGCTAGACAGTTTCCTTGGATGCGCCAAACTTACGATGGATCGTATACTTGTGATCGCTATCGCGATAGTCGA
GGACTTTTCGGGTGTGGAACCAACTACGGATGGTGGACGACACCACCTTGCTCTTGCGACGATGACGTGGACTAT
ATATCGGGTATGCAATTACTAGAAGATGAACCTAAAGAGGAACGTCAGGGTTGGTTGCTCCCTGACGATGAAATT
CCTTGGCTAGATTTTGAGTCCATGGATATCGCCCCTCCTACAGCTCCGCCTAACTTCGAACATAACTGGACGAGC
TATTACGAGTGGCGTGGCCTTCCCTTGCGTTCGCCAGCGGCGCTACTTTTACACTGGCCGCTCTCCACATACCGT
CTACTCTGCCAATTGAATTGTATACCATCCGATATTCCTATGCAACGGCGACGTCTCACTGTGCATCTTTTGGGC
GTTACGCGGGAGCTCGACCTACTTCCTCTTTTTGGAGAACTGGCGCTCTTGATCCCTAATACTGACATCGAACTT
GTCATGTTCGGATCTGGTGTATTCCGCGTCCTCATGGAAGCCGAAAATGACGAGGATTGTATAGCATCTCAGCCC
TACGCTTATACCTATACCGCCCCTGATGCATCTGGTGGAAGCACGATCAAGATTTCCCTATCCGACGCTGGACCT
ATCTGGGGTGACCAGGAGATTCATATACCTTCGAAGCGCCCAGATGCCATGATTGCCCTAGATGCCAACTTTGAT
GGTTGCGGTCAATGGCAACTCGCACTTCTCGCTTCTCGGGCATACAATATTCCTTTTGCGGTAACAGAATCCCAA
GAAGTGAATATTGATTTTAGTATGTCGGCACTTCGCGAACTTCCAGCAGCAAGGAAAACGATGTGGGCGTGGGTT
GATCTTAATGAGGAGGAAGAGAAGAGGATTCGTAAGACGGCTACAAAGACGTATACTTGGGGTTTGAATCCTTTT
ATGTGTCCTGGACCTAAACCTCAGGCGTTGGGAGGTGGACCTATGGCGTCCAATGGGTTTGAGTTTATTATCACG
ACGGGTGGTGCGGATGAAGATGCGGATCCTGTGAAGTTGAAAAAGCGCGGTCCGTTGTTGGATGATTATATGTAG
Transcript >Agabi119p4|064660
ATGGCCCCCGCCGCCCTCGACTCTTCTGTCTTCTTCGACCCTAGCGACCTCAACGACATCGATGCCATCTTGCAT
TACGACGATGATCCAAAGCATTCGACGCATGTCTGTTTGAATTGCCGTCGAGTGGAGACCCCTGACCACAAACTC
GTTCCTTGTGCTCAGTGTAAATCCGTCTTTTATTGTGATGTCGTCTGTTCCAACGAGAATTGGCTGAAGGGCAGG
AGAGGCTCACTCCGCCACAGGGATGTTTGTAGGTTCTTGAGACGCAGCCACAAAAAGCGTCCAGCAATGCAGGCC
ATTGCTAGACAGTTTCCTTGGATGCGCCAAACTTACGATGGATCGTATACTTGTGATCGCTATCGCGATAGTCGA
GGACTTTTCGGGTGTGGAACCAACTACGGATGGTGGACGACACCACCTTGCTCTTGCGACGATGACGTGGACTAT
ATATCGGGTATGCAATTACTAGAAGATGAACCTAAAGAGGAACGTCAGGGTTGGTTGCTCCCTGACGATGAAATT
CCTTGGCTAGATTTTGAGTCCATGGATATCGCCCCTCCTACAGCTCCGCCTAACTTCGAACATAACTGGACGAGC
TATTACGAGTGGCGTGGCCTTCCCTTGCGTTCGCCAGCGGCGCTACTTTTACACTGGCCGCTCTCCACATACCGT
CTACTCTGCCAATTGAATTGTATACCATCCGATATTCCTATGCAACGGCGACGTCTCACTGTGCATCTTTTGGGC
GTTACGCGGGAGCTCGACCTACTTCCTCTTTTTGGAGAACTGGCGCTCTTGATCCCTAATACTGACATCGAACTT
GTCATGTTCGGATCTGGTGTATTCCGCGTCCTCATGGAAGCCGAAAATGACGAGGATTGTATAGCATCTCAGCCC
TACGCTTATACCTATACCGCCCCTGATGCATCTGGTGGAAGCACGATCAAGATTTCCCTATCCGACGCTGGACCT
ATCTGGGGTGACCAGGAGATTCATATACCTTCGAAGCGCCCAGATGCCATGATTGCCCTAGATGCCAACTTTGAT
GGTTGCGGTCAATGGCAACTCGCACTTCTCGCTTCTCGGGCATACAATATTCCTTTTGCGGTAACAGAATCCCAA
GAAGTGAATATTGATTTTAGTATGTCGGCACTTCGCGAACTTCCAGCAGCAAGGAAAACGATGTGGGCGTGGGTT
GATCTTAATGAGGAGGAAGAGAAGAGGATTCGTAAGACGGCTACAAAGACGTATACTTGGGGTTTGAATCCTTTT
ATGTGTCCTGGACCTAAACCTCAGGCGTTGGGAGGTGGACCTATGGCGTCCAATGGGTTTGAGTTTATTATCACG
ACGGGTGGTGCGGATGAAGATGCGGATCCTGTGAAGTTGAAAAAGCGCGGTCCGTTGTTGGATGATTATATGTAG
Gene >Agabi119p4|064660
ATGGCCCCCGCCGCCCTCGACTCTTCTGTCTTCTTCGACCCTAGCGACCTCAACGACATCGATGCCATCTTGCAT
TACGACGATGATCCAAAGCATTCGACGCATGTCTGTTTGAATTGCCGTCGAGTGGAGACCCCTGACCACGTATGT
CTTCCTCTTTCAAATCATTTCGAATACTAATTTCTGTGCAGAAACTCGTTCCTTGTGCTCAGTGTAAATCCGTCT
TTTATTGTGATGTCGTCGTACGCCCCAATCGTTATCTACCATTTTATAAGACATCTGATGCGCCTAATCTTTTAA
TTAGTGTTCCAACGAGAATTGGCTGAAGGGCAGGAGAGGCTCACTCCGCCACAGGGATGTTTGTAGGTTCTTGAG
AGTGAGTCGAAAACTTCTTTCCCTTTTTGGAACGTCTTCTAAATCTCAAAGTAGCGCAGCCACAAAAAGCGTCCA
GCAATGCAGGCCATTGCTAGACAGTTTCCTTGGATGCGCCAAACTTACGATGGATCGTATACTTGTGATCGCTAT
CGCGATAGTCGAGGACTTTTCGGGTGTGGAACCAACTACGGATGGTGGACGACACCACCTTGCTCTTGCGACGAT
GACGTGGACTATATATCGGGTATGCAATTACTAGAAGATGAACCTAAAGAGGAACGTCAGGGTTGGTTGCTCCCT
GACGATGAAATTCCTTGGCTAGATTTTGAGTCCATGGATATCGCCCCTCCTACAGCTCCGCCTAACTTCGAACAT
AACTGGACGAGCTATTACGAGTGGCGTGGCCTTCCCTTGCGTTCGCCAGCGGCGCTACTTTTACACTGGCCGCTC
TCCACATACCGTCTACTCTGCCAATTGAATTGTATACCATCCGATATTCCTATGCAACGGCGACGTCTCACTGTG
CATCTTTTGGGCGTTACGCGGGAGCTCGACCTACTTCCTCTGTACGAAGCTTTCTATTTATCTGAATTATTCTAT
GTTAACCTTTTGCATGATAGTTTTGGAGAACTGGCGCTCTTGATCCCTAATACTGACATCGAACTTGTCATGTTC
GGATCTGGTGTATTCCGCGTCCTCATGGAAGCCGAAAATGACGAGGATTGTATAGCATCTCAGCCCTACGCTTAT
ACCTATACCGCCCCTGATGCATCTGGTGGAAGCACGATCAAGATTTCCCTATCCGACGCTGGACCTATCTGGGGT
GACCAGGAGATTCATATACCTTCGAAGCGCCCAGATGCCATGATTGCCCTAGATGCCAACTTTGATGGTTGCGGT
CAATGGCAACTCGCACTTCTCGCTTCTCGGGCATACAATATTCCTTTTGCGGTAACAGAATCCCAAGAAGTGAAT
ATTGATTTTAGTATGTCGGCACTTCGCGAACTTCCAGCAGCAAGGAAAACGATGTGGGCGTGGGTTGATCTTAAT
GAGGAGGAAGAGAAGAGGATTCGTAAGACGGCTACAAAGACGTATACTTGGGGTTTGAATCCTTTTATGTGTCCT
GGACCTAAACCTCAGGCGTTGGGAGGTGGACCTATGGCGTCCAATGGGTTTGAGTTTATTATCACGACGGGTGGT
GCGGATGAAGATGCGGATCCTGTGAAGTTGAAAAAGCGCGGTCCGTTGTTGGATGATTATATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail