Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|063390
Gene name
Locationscaffold_03b:695591..698487
Strand+
Gene length (bp)2896
Transcript length (bp)2619
Coding sequence length (bp)2619
Protein length (aa) 873

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15913 Furin-like_2 Furin-like repeat, cysteine-rich 6.8E-07 473 540
PF00053 Laminin_EGF Laminin EGF domain 6.4E-05 206 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 207 626 3.0E-27
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 311 625 1.0E-26
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 626 1.0E-23
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 222 626 3.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 355 640 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 207 626 3.0E-27
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 311 625 1.0E-26
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 626 1.0E-23
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 222 626 3.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 355 640 5.0E-23
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 355 617 6.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 232 640 8.0E-22
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 304 626 2.0E-21
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 308 625 3.0E-21
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 336 625 2.0E-20
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 303 625 4.0E-20
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 230 619 5.0E-20
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 301 619 5.0E-20
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 308 627 5.0E-20
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 230 628 4.0E-19
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 301 619 5.0E-19
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 230 627 6.0E-19
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 380 626 7.0E-19
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 303 626 8.0E-19
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 614 1.0E-18
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 310 627 1.0E-18
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 287 626 2.0E-18
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 381 646 2.0E-18
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 382 625 1.0E-17
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 307 582 1.0E-17
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 307 613 2.0E-17
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 230 627 3.0E-17
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 211 624 1.0E-16
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 236 638 4.0E-16
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 320 626 5.0E-16
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 461 627 2.0E-15
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 222 625 2.0E-15
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 390 646 2.0E-15
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 310 625 6.0E-15
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 307 579 9.0E-15
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 304 625 2.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 461 627 3.0E-14
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 310 640 7.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 314 602 4.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 369 616 6.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 314 608 5.0E-12
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 304 626 2.0E-11
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 369 563 4.0E-11
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 368 563 5.0E-11
sp|P92127|VS41_GIAIN Variant-specific surface protein VSP4A1 OS=Giardia intestinalis PE=1 SV=1 460 642 2.0E-10
sp|Q9Y6N6|LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens GN=LAMC3 PE=1 SV=3 204 325 1.0E-09
sp|P55268|LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens GN=LAMB2 PE=1 SV=2 207 470 2.0E-09
sp|P02469|LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus GN=Lamb1 PE=1 SV=3 142 596 8.0E-09
sp|Q9CYA0|CREL2_MOUSE Cysteine-rich with EGF-like domain protein 2 OS=Mus musculus GN=Creld2 PE=1 SV=1 238 417 2.0E-08
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 221 342 3.0E-08
sp|Q6UXH1|CREL2_HUMAN Cysteine-rich with EGF-like domain protein 2 OS=Homo sapiens GN=CRELD2 PE=1 SV=1 238 440 4.0E-08
sp|P15800|LAMB2_RAT Laminin subunit beta-2 OS=Rattus norvegicus GN=Lamb2 PE=2 SV=1 110 470 6.0E-08
sp|Q61292|LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus GN=Lamb2 PE=1 SV=2 136 470 7.0E-08
sp|Q9H1U4|MEGF9_HUMAN Multiple epidermal growth factor-like domains protein 9 OS=Homo sapiens GN=MEGF9 PE=2 SV=3 185 412 7.0E-08
sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN=LAMA5 PE=1 SV=8 179 347 1.0E-07
sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster GN=LanB1 PE=1 SV=4 89 350 1.0E-07
sp|P0CY46|EGFR_APIME Epidermal growth factor receptor OS=Apis mellifera GN=Egfr PE=2 SV=1 379 716 1.0E-07
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 246 483 2.0E-07
sp|Q4G063|CREL2_RAT Cysteine-rich with EGF-like domain protein 2 OS=Rattus norvegicus GN=Creld2 PE=1 SV=1 238 417 2.0E-07
sp|Q9R0B6|LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus GN=Lamc3 PE=1 SV=2 204 325 2.0E-07
sp|Q8R4Y4|STAB1_MOUSE Stabilin-1 OS=Mus musculus GN=Stab1 PE=1 SV=1 221 268 3.0E-07
sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN=Lama5 PE=1 SV=4 219 346 4.0E-07
sp|P07942|LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens GN=LAMB1 PE=1 SV=2 142 596 5.0E-07
sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 207 408 6.0E-07
sp|P35590|TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens GN=TIE1 PE=1 SV=1 135 313 6.0E-07
sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 206 362 9.0E-07
sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 221 308 1.0E-06
sp|Q2KIT5|CREL2_BOVIN Cysteine-rich with EGF-like domain protein 2 OS=Bos taurus GN=CRELD2 PE=2 SV=1 238 412 1.0E-06
sp|Q7SXF6|CREL2_DANRE Cysteine-rich with EGF-like domain protein 2 OS=Danio rerio GN=creld2 PE=2 SV=2 238 417 2.0E-06
sp|Q60438|CREL2_CRIGR Cysteine-rich with EGF-like domain protein 2 OS=Cricetulus griseus GN=CRELD2 PE=2 SV=1 238 417 2.0E-06
sp|A0JP86|LAMC1_XENTR Laminin subunit gamma-1 OS=Xenopus tropicalis GN=lamc1 PE=2 SV=1 217 325 3.0E-06
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 221 268 3.0E-06
sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 222 342 3.0E-06
sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio GN=lamc1 PE=2 SV=2 206 325 4.0E-06
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 237 494 6.0E-06
sp|Q96KG7|MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens GN=MEGF10 PE=1 SV=1 217 666 6.0E-06
sp|P24348|LET23_CAEEL Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans GN=let-23 PE=1 SV=3 472 625 7.0E-06
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 494 627 8.0E-06
sp|Q06807|TIE2_BOVIN Angiopoietin-1 receptor OS=Bos taurus GN=TEK PE=2 SV=1 211 311 9.0E-06
sp|Q06806|TIE1_MOUSE Tyrosine-protein kinase receptor Tie-1 OS=Mus musculus GN=Tie1 PE=1 SV=3 209 313 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 684 706 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|063390
MITILARALIIGFFAAHSAAQSNQTVVCVAGQCVEGITNTTLGARLTASDTSISLHLLPGTYSSTTSPQLLHNLL
TSSSASLSPSTGFENASKSFNPTDLPFELDLSPGITIYDGLLYSGQSLYGGFPDKPPPDQKSSQKDITLGSLAIS
QNVFIVIGGSSDSDDRVVVWNSIPDIRQLPSSASLPASSSSSSTATLRIIDVGSSTCNPQCSGNSICSPTTGRCV
CAPGFTGTSCESCSPGLFGPTCQACPDGCDQCDEGISGSGICLKKTVTGKPGDCGCVNGQCGSNGQCACNAGWKD
GDDGRKCSKCQDGFFLTSTGDCQVCQLGCSRCADTSGTCVQCNAGFAIDTADNTKCNLVRQPTSTGQQCPDGSFS
NGDTCAACASDCETCTGATSNDCATCASGRFKLNGNCVTTNSDGTCVGATGMIANNIKSECDACPSKCTSCAYSS
FSVASTIDQSQCTGCLPGFFLSQGKCVESCPAGTFLSPQDNLNCIPCDSSCGTCIDSADFCLTCSTAGRLASDGK
CVSSCPSNTFPSNSTSCGTCHGDCASCSGPQFNQCTSCPPNRPVLKDGRCLSTCAKGEFFDKTSSSCTGCDSNCE
TCSASGPDKCLSCTSGEVLRSGKCVKTEGGCQTLAGFGVCLEELVITVGQNHTTNATTPAQPKPSISGIADPTVV
RVENKLEGWQIALMVLGVVFILCILIILWRWRARRKRKERTQAWAARRKVLGNMPWWKRMFASRWRDRSSRMEKE
GRLPQYRDEVSRSTRADSTVDGFIDAYADARSSRSDVGSRSLFSEVTGSRRKAPEPRVPVRSSVSTVATSQKSWR
ISETEAARYARSIREQPGPAAGEESLSGLPPFLATEPFERNPFRRRT*
Coding >Agabi119p4|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGCTGCTCAGTCGAATCAAACC
GTTGTATGCGTTGCTGGTCAATGCGTAGAAGGTATAACTAATACTACTCTCGGTGCCCGATTAACCGCATCCGAT
ACATCCATATCCCTACATCTCCTACCAGGGACTTATTCATCCACGACAAGCCCACAACTCCTCCATAACCTTCTC
ACATCTTCCAGTGCATCCCTCTCACCATCTACTGGCTTCGAAAATGCATCCAAATCATTCAACCCGACTGATCTT
CCCTTCGAACTGGATTTATCTCCTGGAATAACTATTTATGATGGTTTACTCTACTCTGGTCAATCATTATATGGT
GGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCTCAAAAAGATATCACGCTTGGCTCTTTGGCGATTTCG
CAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAGTGATGATAGAGTTGTTGTTTGGAATTCCATTCCCGAT
ATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCTTCGTCGTCAAGTTCGACTGCGACCCTTCGAATCATT
GACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGTAATAGTATCTGTTCACCGACAACGGGTCGATGCGTT
TGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGTTCGCCTGGACTTTTTGGACCTACATGTCAAGCATGT
CCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGATCTGGGATATGTTTGAAGAAGACTGTTACTGGCAAA
CCTGGAGATTGTGGGTGTGTGAATGGACAATGTGGGAGTAATGGACAGTGCGCTTGTAATGCTGGGTGGAAAGAT
GGTGATGATGGGAGGAAATGTTCGAAATGCCAAGATGGCTTCTTCTTGACTTCGACGGGGGATTGTCAAGTATGC
CAACTGGGGTGTTCACGTTGCGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGCTTTGCTATAGATACC
GCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCGGATGGAAGTTTTAGC
AATGGTGATACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCGAATGATTGTGCCACT
TGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGTGATGGAACTTGTGTAGGTGCTACT
GGGATGATTGCGAATAATATCAAGAGCGAATGTGATGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGT
TTCAGTGTTGCTTCGACCATTGACCAGTCACAATGTACAGGCTGTTTACCCGGTTTCTTCCTGTCGCAAGGAAAA
TGTGTTGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCCTTGCGACTCTTCA
TGTGGTACTTGCATTGATTCGGCCGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAA
TGCGTTTCTTCTTGTCCCTCCAACACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCT
TCTTGTTCAGGCCCTCAATTCAACCAATGCACATCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGT
TTGTCCACATGTGCTAAAGGGGAATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAA
ACTTGTTCCGCATCGGGTCCTGACAAGTGCTTGAGTTGCACGTCGGGAGAAGTGTTACGGTCGGGAAAATGCGTT
AAGACTGAGGGAGGATGTCAGACATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAACTGTTGGTCAG
AATCACACCACGAATGCGACAACACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTC
AGAGTCGAAAACAAACTGGAGGGATGGCAGATTGCTTTGATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTT
ATTATTCTATGGCGATGGAGAGCGAGGAGGAAGAGAAAGGAAAGGACACAAGCGTGGGCTGCGCGGCGGAAAGTT
CTCGGAAATATGCCGTGGTGGAAGCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAG
GGGAGGCTACCTCAGTACAGAGACGAGGTGTCGCGATCGACGCGCGCAGACTCGACGGTGGACGGATTCATCGAT
GCCTATGCCGACGCACGTTCAAGCCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGG
AGGAAGGCACCGGAGCCACGCGTCCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGG
ATAAGCGAGACAGAGGCTGCGAGATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGC
CTGTCAGGTTTACCGCCGTTTCTTGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGACATGA
Transcript >Agabi119p4|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGCTGCTCAGTCGAATCAAACC
GTTGTATGCGTTGCTGGTCAATGCGTAGAAGGTATAACTAATACTACTCTCGGTGCCCGATTAACCGCATCCGAT
ACATCCATATCCCTACATCTCCTACCAGGGACTTATTCATCCACGACAAGCCCACAACTCCTCCATAACCTTCTC
ACATCTTCCAGTGCATCCCTCTCACCATCTACTGGCTTCGAAAATGCATCCAAATCATTCAACCCGACTGATCTT
CCCTTCGAACTGGATTTATCTCCTGGAATAACTATTTATGATGGTTTACTCTACTCTGGTCAATCATTATATGGT
GGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCTCAAAAAGATATCACGCTTGGCTCTTTGGCGATTTCG
CAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAGTGATGATAGAGTTGTTGTTTGGAATTCCATTCCCGAT
ATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCTTCGTCGTCAAGTTCGACTGCGACCCTTCGAATCATT
GACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGTAATAGTATCTGTTCACCGACAACGGGTCGATGCGTT
TGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGTTCGCCTGGACTTTTTGGACCTACATGTCAAGCATGT
CCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGATCTGGGATATGTTTGAAGAAGACTGTTACTGGCAAA
CCTGGAGATTGTGGGTGTGTGAATGGACAATGTGGGAGTAATGGACAGTGCGCTTGTAATGCTGGGTGGAAAGAT
GGTGATGATGGGAGGAAATGTTCGAAATGCCAAGATGGCTTCTTCTTGACTTCGACGGGGGATTGTCAAGTATGC
CAACTGGGGTGTTCACGTTGCGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGCTTTGCTATAGATACC
GCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCGGATGGAAGTTTTAGC
AATGGTGATACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCGAATGATTGTGCCACT
TGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGTGATGGAACTTGTGTAGGTGCTACT
GGGATGATTGCGAATAATATCAAGAGCGAATGTGATGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGT
TTCAGTGTTGCTTCGACCATTGACCAGTCACAATGTACAGGCTGTTTACCCGGTTTCTTCCTGTCGCAAGGAAAA
TGTGTTGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCCTTGCGACTCTTCA
TGTGGTACTTGCATTGATTCGGCCGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAA
TGCGTTTCTTCTTGTCCCTCCAACACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCT
TCTTGTTCAGGCCCTCAATTCAACCAATGCACATCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGT
TTGTCCACATGTGCTAAAGGGGAATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAA
ACTTGTTCCGCATCGGGTCCTGACAAGTGCTTGAGTTGCACGTCGGGAGAAGTGTTACGGTCGGGAAAATGCGTT
AAGACTGAGGGAGGATGTCAGACATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAACTGTTGGTCAG
AATCACACCACGAATGCGACAACACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTC
AGAGTCGAAAACAAACTGGAGGGATGGCAGATTGCTTTGATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTT
ATTATTCTATGGCGATGGAGAGCGAGGAGGAAGAGAAAGGAAAGGACACAAGCGTGGGCTGCGCGGCGGAAAGTT
CTCGGAAATATGCCGTGGTGGAAGCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAG
GGGAGGCTACCTCAGTACAGAGACGAGGTGTCGCGATCGACGCGCGCAGACTCGACGGTGGACGGATTCATCGAT
GCCTATGCCGACGCACGTTCAAGCCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGG
AGGAAGGCACCGGAGCCACGCGTCCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGG
ATAAGCGAGACAGAGGCTGCGAGATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGC
CTGTCAGGTTTACCGCCGTTTCTTGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGACATGA
Gene >Agabi119p4|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGGTGAGTTTCTCTGTCCTTTC
AGGATGACATTGGAAACTAATGACAATGTGTGCAGCTGCTCAGTCGAATCAAACCGTTGTATGCGTTGCTGGTCA
ATGCGTAGAAGGTATAACTAATACTACTCGTGCGTTTTCTGCGTTTCTCTTTGATGTTTTTGCTCAACCGTTTGT
TATTCGATAGTCGGTGCCCGATTAACCGCATCCGATACATCCATATCCCTACATCTCCTACCAGGGACTTATTCA
TCCACGACAAGCCCACAACTCCTCCATAACCTTCTCACATCTTCCAGTGCATCCCTCTCACCATCTACTGGCTTC
GAAAATGCATCCAAATCATTCAACCCGACTGATCTTCCCTTCGAACTGGATTTATCTCCTGGAATAACTATTTAT
GATGGTTTACTCTACTCTGGTCAATCATTATATGGTGGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCT
CAAAAAGATATCACGCTTGGCTCTTTGGCGATTTCGCAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAGT
GATGATAGAGTTGTTGTTTGGAATTCCATTCCCGATATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCT
TCGTCGTCAAGTTCGACTGCGACCCTTCGAATCATTGACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGT
AATAGTATCTGTTCACCGACAACGGGTCGATGCGTTTGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGT
TCGCCTGGACTTTTTGGACCTACATGTCAAGCATGTCCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGA
TCTGGGATATGTTTGAAGAAGACTGTTACTGGCAAACCTGGAGATTGTGGGTGTGTGAATGGACAATGTGGGAGT
AATGGACAGTGCGCTTGTAATGCTGGGTGGAAAGATGGTGATGATGGGAGGAAATGTTCGAAATGCCAAGATGGC
TTCTTCTTGACTTCGACGGGGGATTGTCAAGGTAAAGTTACGCTTAAGTCTTTCTCCCCTTGATTTCATTAATTT
TTATTGTTAGTATGCCAACTGGGGTGTTCACGTTGCGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGC
TTTGCTATAGATACCGCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCG
GATGGAAGTTTTAGCAATGGTGATACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCG
AATGATTGTGCCACTTGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGTGATGGAACT
TGTGTAGGTGCTACTGGGATGATTGCGAATAATATCAAGAGCGAATGTGATGGTGAGTGGTTACATTCATCTTAT
AAAGTAGTCAGCGCAAACTGACGTTGGTATAGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGTTTCAG
TGTTGCTTCGACCATTGACCAGTCACAATGTACAGGCTGTTTACCCGGTTTCTTCCTGTCGCAAGGAAAATGTGT
TGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCGTACGTTATTTTATGCTTG
TTGGAATACACAAACTTACACATTTCTAATATTACCAGCTTGCGACTCTTCATGTGGTACTTGCATTGATTCGGC
CGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAATGCGTTTCTTCTTGTCCCTCCAA
CACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCTTCTTGTTCAGGCCCTCAATTCAA
CCAATGCACATCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGTTTGTCCACATGTGCTAAAGGGGA
ATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAAACTTGTTCCGCATCGGGTCCTGA
CAAGTGCTTGAGTTGCACGTCGGGAGAAGTGTTACGGTCGGGAAAATGCGTTAAGACTGAGGGAGGATGTCAGAC
ATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAACTGTTGGTCAGAATCACACCACGAATGCGACAAC
ACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTCAGAGTCGAAAACAAACTGGAGGG
ATGGCAGATTGCTTTGATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTTATTATTCTATGGCGATGGAGAGC
GAGGAGGAAGAGAAAGGAAAGGACACAAGCGTGGGCTGCGCGGCGGAAAGTTCTCGGAAATATGCCGTGGTGGAA
GCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAGGGGAGGCTACCTCAGTACAGAGA
CGAGGTGTCGCGATCGACGCGCGCAGACTCGACGGTGGACGGATTCATCGATGCCTATGCCGACGCACGTTCAAG
CCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGGAGGAAGGCACCGGAGCCACGCGT
CCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGGATAAGCGAGACAGAGGCTGCGAG
ATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGCCTGTCAGGTTTACCGCCGTTTCT
TGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail