Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|063310
Gene name
Locationscaffold_03b:679382..681090
Strand+
Gene length (bp)1708
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00534 Glycos_transf_1 Glycosyl transferases group 1 3.4E-19 224 419
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 1.7E-17 17 206
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 9.8E-09 227 402
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 1.7E-07 18 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 1 440 2.0E-126
sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 2 434 8.0E-107
sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 8 441 5.0E-105
sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 6 466 2.0E-104
sp|Q6FJJ9|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1 1 434 1.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 1 440 2.0E-126
sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 2 434 8.0E-107
sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 8 441 5.0E-105
sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 6 466 2.0E-104
sp|Q6FJJ9|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1 1 434 1.0E-101
sp|Q6C3V7|ALG2_YARLI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG2 PE=3 SV=1 6 449 1.0E-98
sp|Q59LF2|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1 7 437 3.0E-95
sp|Q6BVA4|ALG2_DEBHA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG2 PE=3 SV=2 7 456 3.0E-93
sp|Q8X0H8|ALG2_NEUCR Alpha-1,3/1,6-mannosyltransferase alg-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-2 PE=3 SV=1 8 434 9.0E-92
sp|Q755C1|ALG2_ASHGO Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG2 PE=3 SV=1 6 430 2.0E-91
sp|Q9H553|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1 8 433 7.0E-91
sp|Q9DBE8|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=1 SV=2 8 441 3.0E-88
sp|Q7KWM5|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1 4 440 2.0E-85
sp|Q3TZM9|ALG11_MOUSE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus GN=Alg11 PE=2 SV=1 101 423 3.0E-19
sp|Q7ZW24|ALG11_DANRE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio GN=alg11 PE=2 SV=2 8 423 1.0E-16
sp|Q2TAA5|ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens GN=ALG11 PE=1 SV=2 101 423 4.0E-16
sp|Q5R7Z6|ALG11_PONAB GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii GN=ALG11 PE=2 SV=2 101 423 1.0E-15
sp|Q08B22|ALG11_XENLA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis GN=alg11 PE=2 SV=2 112 417 1.0E-15
sp|Q6P312|ALG11_XENTR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus tropicalis GN=alg11 PE=2 SV=1 112 423 6.0E-14
sp|Q54DM9|ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum GN=alg11 PE=3 SV=1 104 403 1.0E-08
sp|P53993|YMP8_CAEEL Uncharacterized glycosyltransferase B0361.8 OS=Caenorhabditis elegans GN=B0361.8 PE=3 SV=3 104 386 6.0E-08
sp|A1R8N8|MSHA_ARTAT D-inositol 3-phosphate glycosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=mshA PE=3 SV=1 174 401 3.0E-07
sp|D1BD84|MSHA_SANKS D-inositol 3-phosphate glycosyltransferase OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=mshA PE=3 SV=1 133 431 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 453 475 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|063310
MPPRRLRIAFLHPDLGIGGAERFVVDAALGLRKLGHIVDIYTSHWDPNHCFEETKDDSLKVRYVKPPFPRSIKGK
FHILCAHARQMHLVTHLLSANAQSYDVYFVDQLSTCVPFLRVIGSTRVVFYCHFPDKLLANGAFVDGTLLNKQGS
LLKRIYRYPMDWLEEVTTRQADVILANSKFTARVFKSYFPSISQNPDIVYPGINIQAYTSNVDTSNTDVATILSE
TPTLLSLNRFEKKKNAALAIEAFAIMKAREPTQALRLVLAGGYDPRLQDNIQTLRTLTELATTHSLSYNIITPTI
STIPVPDHTKVSTPDIVFLLNFTTAQRTALLNSTSTKALLYTPANEHFGIGPIEGMICGVPVLACDSGGPTESII
DTPSDDRTGWLRPPDPVVWADTLQEILALSPGAREAISSRGRERAREFFSLDAMSKGLEVALLKVVALGSVQNLI
FKVFVMLIGLLAAYVFTSKITSFLIPSRFQ*
Coding >Agabi119p4|063310
ATGCCACCTCGGCGCCTCCGAATAGCTTTCCTTCATCCTGACCTCGGAATTGGCGGTGCCGAACGGTTTGTCGTG
GACGCTGCCCTCGGTCTTCGAAAACTAGGACATATCGTTGATATATATACTTCGCACTGGGATCCAAATCACTGC
TTTGAAGAAACTAAAGACGATAGTCTTAAAGTTCGTTACGTCAAGCCTCCCTTTCCAAGATCTATCAAAGGGAAA
TTCCACATACTATGTGCGCATGCCAGACAGATGCATCTTGTGACTCATCTGCTGAGCGCGAATGCGCAAAGTTAT
GATGTATATTTCGTCGACCAGCTGTCGACATGTGTTCCATTCCTCCGTGTAATTGGAAGCACTCGTGTTGTGTTT
TACTGTCATTTCCCGGACAAGCTATTGGCCAATGGAGCGTTCGTCGACGGAACTCTGTTAAACAAACAGGGTAGT
TTGTTAAAACGAATTTATCGATACCCTATGGATTGGTTGGAGGAAGTTACAACAAGGCAAGCCGATGTTATATTG
GCGAATTCCAAGTTCACCGCGCGAGTCTTCAAGTCGTACTTCCCCTCCATCTCGCAGAACCCAGACATTGTATAC
CCTGGCATAAACATTCAGGCGTACACGTCAAACGTGGACACGAGTAACACTGACGTGGCAACAATACTGTCAGAG
ACACCTACCCTTCTCTCATTGAATCGCTTTGAAAAGAAAAAGAATGCCGCATTGGCTATCGAGGCGTTTGCCATT
ATGAAAGCAAGGGAACCCACCCAGGCTTTGCGTCTCGTACTTGCCGGTGGCTATGATCCACGGCTACAAGATAAT
ATCCAGACGCTAAGAACCCTGACGGAGCTTGCGACTACTCATTCCTTAAGTTATAATATTATAACCCCCACAATA
TCCACGATACCCGTTCCAGACCATACCAAAGTTTCAACACCTGATATCGTGTTCCTGTTAAATTTCACCACTGCA
CAACGAACTGCTCTTCTCAATAGTACATCAACGAAGGCTCTCTTATATACCCCAGCGAACGAACACTTCGGGATT
GGACCCATCGAGGGAATGATATGCGGGGTGCCGGTCCTGGCTTGTGATAGTGGAGGACCAACTGAAAGTATCATT
GATACGCCATCCGATGATCGCACCGGTTGGCTTCGCCCTCCCGATCCCGTTGTATGGGCGGATACATTGCAAGAA
ATACTTGCTCTTTCACCAGGGGCGAGAGAAGCTATATCTTCCAGAGGAAGGGAACGAGCTCGTGAGTTTTTCAGT
TTGGATGCGATGTCGAAGGGATTGGAGGTAGCTCTGTTAAAGGTGGTTGCGTTAGGAAGTGTGCAAAATCTCATT
TTCAAAGTTTTTGTCATGTTGATTGGCCTTCTTGCCGCTTATGTATTTACTTCTAAGATTACTTCTTTTCTTATT
CCTTCACGATTTCAATAA
Transcript >Agabi119p4|063310
ATGCCACCTCGGCGCCTCCGAATAGCTTTCCTTCATCCTGACCTCGGAATTGGCGGTGCCGAACGGTTTGTCGTG
GACGCTGCCCTCGGTCTTCGAAAACTAGGACATATCGTTGATATATATACTTCGCACTGGGATCCAAATCACTGC
TTTGAAGAAACTAAAGACGATAGTCTTAAAGTTCGTTACGTCAAGCCTCCCTTTCCAAGATCTATCAAAGGGAAA
TTCCACATACTATGTGCGCATGCCAGACAGATGCATCTTGTGACTCATCTGCTGAGCGCGAATGCGCAAAGTTAT
GATGTATATTTCGTCGACCAGCTGTCGACATGTGTTCCATTCCTCCGTGTAATTGGAAGCACTCGTGTTGTGTTT
TACTGTCATTTCCCGGACAAGCTATTGGCCAATGGAGCGTTCGTCGACGGAACTCTGTTAAACAAACAGGGTAGT
TTGTTAAAACGAATTTATCGATACCCTATGGATTGGTTGGAGGAAGTTACAACAAGGCAAGCCGATGTTATATTG
GCGAATTCCAAGTTCACCGCGCGAGTCTTCAAGTCGTACTTCCCCTCCATCTCGCAGAACCCAGACATTGTATAC
CCTGGCATAAACATTCAGGCGTACACGTCAAACGTGGACACGAGTAACACTGACGTGGCAACAATACTGTCAGAG
ACACCTACCCTTCTCTCATTGAATCGCTTTGAAAAGAAAAAGAATGCCGCATTGGCTATCGAGGCGTTTGCCATT
ATGAAAGCAAGGGAACCCACCCAGGCTTTGCGTCTCGTACTTGCCGGTGGCTATGATCCACGGCTACAAGATAAT
ATCCAGACGCTAAGAACCCTGACGGAGCTTGCGACTACTCATTCCTTAAGTTATAATATTATAACCCCCACAATA
TCCACGATACCCGTTCCAGACCATACCAAAGTTTCAACACCTGATATCGTGTTCCTGTTAAATTTCACCACTGCA
CAACGAACTGCTCTTCTCAATAGTACATCAACGAAGGCTCTCTTATATACCCCAGCGAACGAACACTTCGGGATT
GGACCCATCGAGGGAATGATATGCGGGGTGCCGGTCCTGGCTTGTGATAGTGGAGGACCAACTGAAAGTATCATT
GATACGCCATCCGATGATCGCACCGGTTGGCTTCGCCCTCCCGATCCCGTTGTATGGGCGGATACATTGCAAGAA
ATACTTGCTCTTTCACCAGGGGCGAGAGAAGCTATATCTTCCAGAGGAAGGGAACGAGCTCGTGAGTTTTTCAGT
TTGGATGCGATGTCGAAGGGATTGGAGGTAGCTCTGTTAAAGGTGGTTGCGTTAGGAAGTGTGCAAAATCTCATT
TTCAAAGTTTTTGTCATGTTGATTGGCCTTCTTGCCGCTTATGTATTTACTTCTAAGATTACTTCTTTTCTTATT
CCTTCACGATTTCAATAA
Gene >Agabi119p4|063310
ATGCCACCTCGGCGCCTCCGAATAGCTTTCCTTCATCCTGACCTCGGAATTGGTATGAATTGACTTTGGACGTGT
ACATTTGCTGATGGGGATCGAAATATAGGCGGTGCCGAACGGTTTGTCGTGGACGCTGCCCTCGGTCTTCGAAAA
CTAGGACATATCGTTGATATATATACTTCGCACTGGGATCCAAATCACTGCTTTGAAGAAACTAAAGACGGTATG
TTCTAGCCTAAAGCTCACAGGAGGAAAGTCAACCTGACGAGCTTGTACAAAAGATAGTCTTAAAGTTCGTTACGT
CAAGCCTCCCTTTCCAAGATCTATCAAAGGGAAATTCCACATACTATGTGCGCATGCCAGACAGATGCATCTTGT
GACTCATCTGCTGAGCGCGAATGCGCAAAGTTATGATGTATATTTCGTCGACCAGCTGTCGACATGTGTTCCATT
CCTCCGTGTAATTGGAAGCACTCGTGTTGTGTTTTACTGTCATTTCCCGGACAAGCTATTGGCCAATGGAGCGTT
CGTCGACGGAACTCTGTTAAACAAACAGGGTAGTTTGTTAAAACGAATTTATCGATACCCTATGGATTGGTTGGA
GGAAGTTACAACAAGTACGCCATTGTATTTACTTGCTTGCAAACCTTTTTTACCATTCGTTAAAGGGCAAGCCGA
TGTTATATTGGCGAATTCCAAGTTCACCGCGCGAGTCTTCAAGTCGTACTTCCCCTCCATCTCGCAGAACCCAGA
CATTGTATACCCTGGCATAAACATTCAGGCGTACACGTCAAACGTGGACACGAGTAACACTGACGTGGCAACAAT
ACTGTCGTTCGTATTATTTCTTTTTTTTTACTTGTCGGTTTGCGAGGCTAATAGATTCATAGAGAGACACCTACC
CTTCTCTCATTGAATCGCTTTGAAAAGAAAAAGAATGCCGCATTGGCTATCGAGGCGTTTGCCATTATGAAAGCA
AGGGAACCCACCCAGGCTTTGCGTCTCGTACTTGCCGGTAAGCAATTTGAGATATATAATGTCCTTTGTGTTGAA
AGGCCTGCCAGGTGGCTATGATCCACGGCTACAAGATAATATCCAGACGCTAAGAACCCTGACGGAGCTTGCGAC
TACTCATTCCTTAAGTTATAATATTATAACCCCCACAATATCCACGATACCCGTTCCAGACCATACCAAAGTTTC
AACACCTGATATCGTGTTCCTGTTAAATTTCACCACTGCACAACGAACTGCTCTTCTCAATAGTACATCAACGAA
GGCTCTCTTATATACCCCAGCGAACGAACACTTCGGGATTGGACCCATCGAGGGAATGATATGCGGGGTGCCGGT
CCTGGCTTGTGATAGTGGAGGACCAACTGAAAGTATCATTGATACGCCATCCGATGATCGCACCGGTTGGCTTCG
CCCTCCCGATCCCGTTGTATGGGCGGATACATTGCAAGAAATACTTGCTCTTTCACCAGGGGCGAGAGAAGCTAT
ATCTTCCAGAGGAAGGGAACGAGCTCGTGAGTTTTTCAGTTTGGATGCGATGTCGAAGGGATTGGAGGTAGCTCT
GTTAAAGGTGGTTGCGTTAGGAAGTGTGCAAAATCTCATTTTCAAAGTTTTTGTCATGTTGATTGGCCTTCTTGC
CGCTTATGTATTTACTTCTAAGATTACTTCTTTTCTTATTCCTTCACGATTTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail