Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|063140
Gene name
Locationscaffold_03b:632262..633537
Strand+
Gene length (bp)1275
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 6.7E-08 5 50

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup4447
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|063140
Agaricus bisporus var bisporus H97 AgabiH97|063140
Agaricus bisporus var burnettii H119p4 Agabi119p4|063140 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|063140
MPNFDELPDDILLEIFQSFLRRKENLGNLRLVSRRISTLVSRLLFRRIVIAMGDGTGEGAATLDESSIISAMTSG
TTTIFEHTRELRIHPEAFGRHLFLSLKPISNPIEFSGFWYASAPHFALEIASLLTRCPNLTRLRLTNGSSQEFTL
KDFFFEAGKMEKALKLQELNLKGLVVDLEGFEPYIRHFRNLKSLAITGNSSSASTDLGAICRILQQHDIYLEDLS
ADNPGDLLVLSYLSSYSGLKRLKFGTWCAKEGNGSEAVNRLYTQVLPKQAEVLEELHIILCNPGVWCEMPTLNQV
AGLAKCRKLKSLSITSTLTPHNGENARTIWELWFRICSQFPNFEHLLVYPMPWLATEREMDSWNIAKEEVMAQYQ
MEKKIKFTVR*
Coding >Agabi119p4|063140
ATGCCCAACTTTGATGAACTGCCAGACGACATTCTTCTGGAAATTTTCCAATCTTTCCTACGTCGCAAAGAAAAT
CTAGGCAACCTTCGTCTTGTCTCTAGGCGTATAAGTACACTTGTTAGCCGTCTCCTCTTTCGTCGAATCGTTATT
GCGATGGGCGATGGTACCGGGGAGGGGGCAGCTACGCTGGATGAATCTAGCATCATTTCTGCCATGACGTCCGGC
ACAACAACTATCTTCGAGCACACCAGAGAGCTGAGAATTCACCCAGAAGCTTTTGGTCGACATCTTTTTCTCTCC
CTCAAACCTATATCCAACCCCATCGAATTCTCAGGATTCTGGTATGCCAGTGCTCCTCACTTCGCACTTGAGATT
GCTTCTCTCTTGACACGATGTCCCAATTTGACACGGCTCCGACTTACAAATGGATCTTCCCAGGAGTTCACTTTA
AAAGATTTTTTTTTCGAGGCTGGAAAGATGGAGAAAGCATTGAAACTGCAGGAGCTCAATCTGAAAGGTCTGGTA
GTCGATCTTGAAGGTTTCGAGCCCTACATACGCCATTTCAGAAACTTGAAGTCACTAGCTATCACAGGAAATAGC
TCAAGCGCATCTACAGACCTCGGAGCAATTTGCCGTATCCTCCAACAACACGACATCTATTTAGAAGACTTATCA
GCTGATAATCCGGGAGACCTCCTTGTCCTCTCTTATCTTTCCTCGTACTCGGGGTTGAAGAGGCTCAAATTTGGA
ACATGGTGTGCAAAAGAGGGGAATGGATCCGAAGCTGTAAACCGGCTCTATACTCAAGTTCTACCGAAGCAAGCT
GAGGTTTTGGAAGAGTTACATATAATACTCTGCAATCCAGGAGTATGGTGTGAGATGCCGACGTTAAATCAGGTT
GCAGGGCTTGCAAAATGTCGCAAGCTCAAAAGTTTGAGCATTACATCCACTCTCACACCCCACAATGGAGAGAAT
GCCAGAACAATTTGGGAGCTTTGGTTTAGAATCTGTTCTCAGTTTCCGAACTTCGAACACTTGTTAGTGTATCCG
ATGCCATGGCTCGCAACCGAACGAGAAATGGACTCTTGGAATATAGCCAAAGAAGAGGTTATGGCGCAGTATCAG
ATGGAAAAGAAAATTAAGTTTACAGTAAGATAA
Transcript >Agabi119p4|063140
ATGCCCAACTTTGATGAACTGCCAGACGACATTCTTCTGGAAATTTTCCAATCTTTCCTACGTCGCAAAGAAAAT
CTAGGCAACCTTCGTCTTGTCTCTAGGCGTATAAGTACACTTGTTAGCCGTCTCCTCTTTCGTCGAATCGTTATT
GCGATGGGCGATGGTACCGGGGAGGGGGCAGCTACGCTGGATGAATCTAGCATCATTTCTGCCATGACGTCCGGC
ACAACAACTATCTTCGAGCACACCAGAGAGCTGAGAATTCACCCAGAAGCTTTTGGTCGACATCTTTTTCTCTCC
CTCAAACCTATATCCAACCCCATCGAATTCTCAGGATTCTGGTATGCCAGTGCTCCTCACTTCGCACTTGAGATT
GCTTCTCTCTTGACACGATGTCCCAATTTGACACGGCTCCGACTTACAAATGGATCTTCCCAGGAGTTCACTTTA
AAAGATTTTTTTTTCGAGGCTGGAAAGATGGAGAAAGCATTGAAACTGCAGGAGCTCAATCTGAAAGGTCTGGTA
GTCGATCTTGAAGGTTTCGAGCCCTACATACGCCATTTCAGAAACTTGAAGTCACTAGCTATCACAGGAAATAGC
TCAAGCGCATCTACAGACCTCGGAGCAATTTGCCGTATCCTCCAACAACACGACATCTATTTAGAAGACTTATCA
GCTGATAATCCGGGAGACCTCCTTGTCCTCTCTTATCTTTCCTCGTACTCGGGGTTGAAGAGGCTCAAATTTGGA
ACATGGTGTGCAAAAGAGGGGAATGGATCCGAAGCTGTAAACCGGCTCTATACTCAAGTTCTACCGAAGCAAGCT
GAGGTTTTGGAAGAGTTACATATAATACTCTGCAATCCAGGAGTATGGTGTGAGATGCCGACGTTAAATCAGGTT
GCAGGGCTTGCAAAATGTCGCAAGCTCAAAAGTTTGAGCATTACATCCACTCTCACACCCCACAATGGAGAGAAT
GCCAGAACAATTTGGGAGCTTTGGTTTAGAATCTGTTCTCAGTTTCCGAACTTCGAACACTTGTTAGTGTATCCG
ATGCCATGGCTCGCAACCGAACGAGAAATGGACTCTTGGAATATAGCCAAAGAAGAGGTTATGGCGCAGTATCAG
ATGGAAAAGAAAATTAAGTTTACAGTAAGATAA
Gene >Agabi119p4|063140
ATGCCCAACTTTGATGAACTGCCAGACGACATTCTTCTGGAAATTTTCCAATCTGTGGGTAACGTTCGGCACATT
CTTTAAGTATGATCCATCGTGTACTAACCCTCACCTAGTTCCTACGTCGCAAAGAAAATCTAGGCAACCTTCGTC
TTGTCTCTAGGCGTATAAGTACACTTGTTAGCCGTCTCCTCTTTCGTCGAATCGTTATTGCGATGGGCGATGGTA
CCGGGGAGGGGGCAGCTACGCTGGATGAATCTAGCATCATTTCTGCCATGACGTCCGGCACAACAACTATCTTCG
AGCACACCAGAGAGCTGAGAATTCACCCAGAAGCTTTTGGTCGACATCTTTTTCTCTCCCTCAAACCTATATCCA
ACCCCATCGAATTCTCAGGATTCTGGTATGCCAGTGCTCCTCACTTCGCACTTGAGATTGCTTCTCTCTTGACAC
GATGTCCCAATTTGACACGGCTCCGACTTACAAATGGATCTTCCCAGGAGTTCACTTTAAAAGATTTTTTTTTCG
AGGCTGGAAAGATGGAGAAAGCATTGAAACTGCAGGAGCTCAATCTGAAAGGTCTGGTAGTCGATCTTGAAGGTT
TCGAGCCCTACATACGCCATTTCAGAAACTTGAAGTCACTAGCTATCACAGGAAATAGCTCAAGCGCATCTACAG
ACCTCGGAGCAATTTGCCGTATCCTCCAACAACACGACATCTATTTAGAAGACTTATCAGCTGATAATCCGGGAG
ACCTCCTTGTCCTCTCTTATCTTTCCTCGTACTCGGGGTTGAAGAGGCTCAAATTTGGAACATGGTGTGCAAAAG
AGGGGAATGGATCCGAAGCTGTAAACCGGCTCTATACTCAAGTTCTACCGAAGCAAGCTGAGGTTTTGGAAGAGT
TACATATAATACTCTGCAATCCAGGAGTATGGTGTGAGATGCCGACGTTAAATCAGGTTGCAGGGCTTGCAAAAT
GTCGCAAGCTCAAAAGTTTGAGCATTACATCCACTCTCACACCCCACAATGGAGAGAATGCCAGAACAATTTGGG
CAAGTGCTTTTCCCCCTTCACTCAGATCGCCAATTTACTAAGTGTTAGGACTTCTAGGAGCTTTGGTTTAGAATC
TGTTCTCAGTTTCCGAACTTCGAACACTTGTTAGTGTATCCGATGCCATGGCTCGCAACCGAACGAGAAATGGAC
TCTTGGAATATAGCCAAAGAAGAGGTTATGGCGCAGTATCAGATGGAAAAGAAAATTAAGTTTACAGTAAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail