Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|063100
Gene name
Locationscaffold_03b:626549..627868
Strand-
Gene length (bp)1319
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 3.4E-15 68 266
PF17778 BLACT_WH Beta-lactamase associated winged helix domain 9.8E-15 323 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 41 360 4.0E-54
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 44 360 6.0E-52
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 44 373 9.0E-52
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 44 373 3.0E-50
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 44 362 7.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 41 360 4.0E-54
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 44 360 6.0E-52
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 44 373 9.0E-52
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 44 373 3.0E-50
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 44 362 7.0E-50
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 44 358 8.0E-49
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 44 373 1.0E-48
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 44 339 7.0E-44
sp|Q95Q18|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1 47 360 2.0E-43
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|063100
MRGLLTRLPSVSSHTRFVFNCGLFNRALSSSTKFRNMVEKLEDLPDISKISASVTRILGQNPGKFTLQGTNTYVI
GTQHPYVLLDPGEGKQEYLPLLSSALDALSSNTNTLPEVSDIMISHWHSDHVGGLPSVLSLLQSRWQSRNPTTPL
SSYPAPKLHKYPLPSDVAGPASTAHNKLPEIIESLPKGAFTPTPDGKPFHDLHDNQLFRASSPAIRVIHSPGHTL
DSIALDIPDDHALYTADTVLGQGTAIFEDLRLYLQSLNKLLEYGKKAPEGYQTLYPAHGPIVKSGHELISTYIKH
RLDREQQVLEVLRTKPTEGDAWTTWTIVKVLYASYPESLWIPASHSIDLHLKKLQDEGTVVFLGGEGVEKAWKLD
CESPSS*
Coding >Agabi119p4|063100
ATGAGGGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCATCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGATC
AGCGCCAGCGTAACGCGGATTCTTGGACAGAATCCTGGAAAGTTCACTCTTCAAGGGACTAACACCTATGTCATC
GGTACTCAACATCCCTATGTCCTCCTTGATCCAGGAGAAGGAAAACAAGAATATCTTCCCCTTCTCTCCTCCGCC
CTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCATGATTTCGCATTGGCATTCCGAC
CACGTCGGTGGTCTCCCATCTGTTCTCTCTCTGCTCCAATCACGTTGGCAATCCCGTAACCCAACAACTCCGCTA
TCCTCGTATCCAGCTCCCAAATTACATAAATACCCTCTCCCATCAGATGTCGCCGGTCCTGCATCTACTGCTCAT
AACAAACTACCCGAAATCATCGAATCATTACCCAAAGGCGCATTCACACCTACACCCGACGGCAAACCCTTCCAT
GACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAATCCATTCTCCTGGACATACGCTT
GACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACACAGTTCTAGGACAAGGCACCGCC
ATCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAATATGGCAAGAAAGCTCCTGAGGGT
TATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAACTCATCTCCACTTATATTAAACAT
CGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGGAAGGCGATGCTTGGACTACTTGG
ACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAGCCTCTCATAGTATTGACCTTCAT
CTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTGTGGAAAAGGCTTGGAAGCTAGAC
TGCGAAAGTCCATCGTCGTAG
Transcript >Agabi119p4|063100
ATGAGGGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCATCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGATC
AGCGCCAGCGTAACGCGGATTCTTGGACAGAATCCTGGAAAGTTCACTCTTCAAGGGACTAACACCTATGTCATC
GGTACTCAACATCCCTATGTCCTCCTTGATCCAGGAGAAGGAAAACAAGAATATCTTCCCCTTCTCTCCTCCGCC
CTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCATGATTTCGCATTGGCATTCCGAC
CACGTCGGTGGTCTCCCATCTGTTCTCTCTCTGCTCCAATCACGTTGGCAATCCCGTAACCCAACAACTCCGCTA
TCCTCGTATCCAGCTCCCAAATTACATAAATACCCTCTCCCATCAGATGTCGCCGGTCCTGCATCTACTGCTCAT
AACAAACTACCCGAAATCATCGAATCATTACCCAAAGGCGCATTCACACCTACACCCGACGGCAAACCCTTCCAT
GACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAATCCATTCTCCTGGACATACGCTT
GACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACACAGTTCTAGGACAAGGCACCGCC
ATCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAATATGGCAAGAAAGCTCCTGAGGGT
TATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAACTCATCTCCACTTATATTAAACAT
CGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGGAAGGCGATGCTTGGACTACTTGG
ACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAGCCTCTCATAGTATTGACCTTCAT
CTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTGTGGAAAAGGCTTGGAAGCTAGAC
TGCGAAAGTCCATCGTCGTAG
Gene >Agabi119p4|063100
ATGAGGGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCATCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGGTG
CGCCGTCTTCTGTTTCGGACAACGAAGTGATTGAACGCTTTTCGCTAGATCAGCGCCAGCGTAACGCGGATTCTT
GGACAGGTCAGTCGCCTGTATCGTGCTACAATTTCTATTCACCTCATGTACCATTTTTGCCACTAGAATCCTGGA
AAGTTCACTCTTCAAGGTCCCCTGCTTTAATTAGAATGTTTGAATCCCTGCTTACGGTTTCCGAATATCTTTTTG
CAGGGACTAACACCTATGTCATCGGTACTCAACATCCCTATGTCCTCCTTGATCCAGGAGAAGGAAAACAAGAAT
ATCTTCCCCTTCTCTCCTCCGCCCTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCA
TGATTTCGCATTGGCATTCCGACCACGTCGGTGGTCTCCCATCTGTTCTCTCTCTGCTCCAATCACGTTGGCAAT
CCCGTAACCCAACAACTCCGCTATCCTCGTATCCAGCTCCCAAATTACATAAATACCCTCTCCCATCAGATGTCG
CCGGTCCTGCATCTACTGCTCATAACAAACTACCCGAAATCATCGAATCATTACCCAAAGGCGCATTCACACCTA
CACCCGACGGCAAACCCTTCCATGACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAA
TCCATTCTCCTGGACATACGCTTGACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACA
CAGTTCTAGGACAAGGCACCGCCATCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAAT
ATGGCAAGAAAGCTCCTGAGGGTTATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAAC
TCATCTCCACTTATATTAAACATCGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGG
AAGGCGATGCTTGGACTACTTGGACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAG
CCTCTCATAGTATTGACCTTCATCTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTG
TGGAAAAGGCTTGGAAGCTAGACTGCGAAAGTCCATCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail