Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|062850
Gene name
Locationscaffold_03b:580238..583753
Strand+
Gene length (bp)3515
Transcript length (bp)2970
Coding sequence length (bp)2970
Protein length (aa) 990

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 6.3E-38 714 924
PF00005 ABC_tran ABC transporter 4.3E-23 396 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 360 924 1.0E-75
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 392 924 4.0E-75
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 392 924 5.0E-75
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 392 924 1.0E-74
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 23 638 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 360 924 1.0E-75
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 392 924 4.0E-75
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 392 924 5.0E-75
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 392 924 1.0E-74
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 23 638 1.0E-74
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 392 924 2.0E-74
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 392 924 4.0E-73
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 392 924 2.0E-72
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 363 910 5.0E-70
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 23 639 2.0E-69
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 392 954 4.0E-68
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 363 846 4.0E-67
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 349 929 1.0E-64
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 385 950 1.0E-63
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 364 924 1.0E-62
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 365 926 9.0E-62
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 363 929 1.0E-61
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 387 928 2.0E-61
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 365 925 2.0E-61
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 393 924 3.0E-61
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 389 924 1.0E-60
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 391 924 4.0E-60
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 387 983 6.0E-60
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 365 924 1.0E-59
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 364 924 1.0E-59
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 391 940 3.0E-59
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 387 973 3.0E-59
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 365 924 4.0E-59
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 349 989 6.0E-59
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 393 986 6.0E-58
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 361 926 1.0E-57
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 361 926 2.0E-57
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 365 924 3.0E-57
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 392 989 1.0E-56
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 32 648 2.0E-56
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 395 924 3.0E-56
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 361 929 7.0E-56
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 393 920 1.0E-55
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 346 989 4.0E-55
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 393 950 6.0E-55
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 361 915 2.0E-54
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 361 915 4.0E-54
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 360 989 5.0E-54
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 360 989 1.0E-53
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 386 987 2.0E-53
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 344 973 2.0E-51
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 395 924 2.0E-51
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 353 923 3.0E-51
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 343 915 6.0E-51
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 374 923 2.0E-50
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 395 957 2.0E-50
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 392 989 3.0E-50
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 375 927 3.0E-50
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 349 920 9.0E-50
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 387 977 1.0E-49
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 391 922 1.0E-49
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 395 975 2.0E-49
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 392 924 3.0E-49
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 395 978 4.0E-49
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 395 973 4.0E-49
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 395 978 4.0E-49
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 353 920 6.0E-49
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 390 923 6.0E-49
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 395 975 8.0E-49
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 392 924 1.0E-48
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 395 926 1.0E-48
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 394 936 3.0E-48
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 353 923 3.0E-48
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 384 975 4.0E-48
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 360 970 5.0E-48
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 395 926 8.0E-48
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 395 924 1.0E-47
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 395 957 1.0E-47
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 388 922 2.0E-47
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 390 926 2.0E-47
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 395 926 2.0E-47
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 390 978 4.0E-47
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 395 926 6.0E-47
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 395 977 6.0E-47
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 395 975 6.0E-47
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 384 920 7.0E-47
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 392 989 8.0E-47
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 394 926 8.0E-47
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 367 986 1.0E-46
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 389 957 3.0E-46
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 353 923 3.0E-46
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 395 926 3.0E-46
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 396 920 7.0E-46
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 358 950 1.0E-45
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 395 975 1.0E-45
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 365 978 2.0E-45
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 367 933 2.0E-45
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 395 973 5.0E-45
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 364 920 5.0E-45
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 395 976 8.0E-45
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 390 923 9.0E-45
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 395 924 2.0E-44
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 391 976 2.0E-44
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 390 926 7.0E-44
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 395 926 8.0E-44
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 395 969 1.0E-43
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 395 970 2.0E-43
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 395 957 2.0E-43
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 676 975 4.0E-43
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 382 987 5.0E-43
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 395 924 8.0E-43
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 394 960 9.0E-43
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 395 975 1.0E-42
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 395 976 1.0E-42
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 390 969 2.0E-42
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 385 924 3.0E-42
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 388 925 3.0E-42
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 395 924 4.0E-42
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 358 920 5.0E-42
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 382 987 6.0E-42
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 395 924 9.0E-42
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 389 929 1.0E-41
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 390 969 2.0E-41
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 390 970 2.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 388 920 2.0E-41
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 395 975 2.0E-41
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 365 646 3.0E-41
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 395 924 5.0E-41
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 361 926 6.0E-41
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 358 920 6.0E-41
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 389 954 1.0E-40
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 380 988 1.0E-40
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 395 936 1.0E-40
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 390 969 1.0E-40
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 387 926 1.0E-40
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 395 638 1.0E-40
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 395 969 2.0E-40
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 395 969 2.0E-40
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 396 924 2.0E-40
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 357 920 2.0E-40
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 395 946 5.0E-40
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 355 834 8.0E-40
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 394 927 9.0E-40
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 391 960 1.0E-39
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 385 924 1.0E-39
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 385 924 1.0E-39
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 393 871 1.0E-39
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 358 900 2.0E-39
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 394 957 2.0E-39
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 361 681 6.0E-39
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 395 924 8.0E-39
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 395 927 1.0E-38
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 384 947 2.0E-38
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 395 924 4.0E-38
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 395 924 5.0E-38
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 394 975 8.0E-38
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 394 925 1.0E-37
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 358 920 1.0E-37
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 395 924 2.0E-37
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 395 942 2.0E-37
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 395 927 3.0E-37
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 387 924 3.0E-37
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 394 927 4.0E-37
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 384 924 8.0E-37
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 395 924 1.0E-36
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 387 926 1.0E-36
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 387 924 2.0E-36
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 395 924 2.0E-36
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 389 924 2.0E-36
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 395 970 2.0E-36
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 393 920 4.0E-36
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 364 823 7.0E-36
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 395 924 8.0E-36
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 369 924 8.0E-36
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 395 926 4.0E-35
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 391 952 4.0E-35
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 390 657 4.0E-35
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 391 924 7.0E-35
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 395 924 1.0E-34
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 395 926 2.0E-34
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 394 924 3.0E-34
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 356 903 4.0E-34
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 387 924 5.0E-34
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 395 924 8.0E-34
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 387 924 1.0E-33
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 388 924 2.0E-33
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 387 927 3.0E-33
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 395 924 4.0E-33
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 346 800 4.0E-33
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 393 924 6.0E-33
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 395 924 7.0E-33
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 395 924 1.0E-32
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 392 924 2.0E-32
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 395 925 3.0E-32
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 387 988 4.0E-32
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 394 924 5.0E-32
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 387 927 6.0E-32
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 394 924 9.0E-32
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 395 925 1.0E-31
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 393 920 2.0E-31
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 394 924 7.0E-31
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 353 798 7.0E-31
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 353 834 2.0E-30
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 394 924 6.0E-30
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 712 988 2.0E-29
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 353 798 2.0E-29
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 395 976 5.0E-29
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 387 924 7.0E-29
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 388 924 1.0E-28
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 395 924 2.0E-28
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 395 939 4.0E-28
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 364 897 2.0E-27
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 387 924 3.0E-27
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 708 989 3.0E-26
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 392 920 1.0E-25
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 358 920 7.0E-25
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 683 988 1.0E-24
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 314 919 3.0E-24
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 390 925 1.0E-23
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 365 566 2.0E-23
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 396 925 6.0E-23
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 365 566 7.0E-21
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 358 920 9.0E-21
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 392 606 2.0E-19
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 392 552 2.0E-19
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 392 552 2.0E-19
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 392 552 2.0E-19
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 729 952 6.0E-19
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 392 552 6.0E-19
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 388 601 1.0E-18
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 392 552 1.0E-18
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 392 552 4.0E-18
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 392 552 1.0E-17
sp|P44656|Y354_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0354 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0354 PE=3 SV=1 393 587 1.0E-17
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 395 606 3.0E-17
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 392 552 3.0E-17
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 392 566 4.0E-17
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 388 600 5.0E-17
sp|Q31GF5|LOLD_THICR Lipoprotein-releasing system ATP-binding protein LolD OS=Thiomicrospira crunogena (strain XCL-2) GN=lolD PE=3 SV=1 389 601 5.0E-17
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 395 924 6.0E-17
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 393 559 1.0E-16
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 403 626 1.0E-16
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 403 626 1.0E-16
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 403 626 1.0E-16
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 403 626 1.0E-16
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 396 607 1.0E-16
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 396 559 2.0E-16
sp|P0A9U0|YBBA_SHIFL Uncharacterized ABC transporter ATP-binding protein YbbA OS=Shigella flexneri GN=ybbA PE=3 SV=1 388 566 2.0E-16
sp|P0A9T8|YBBA_ECOLI Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli (strain K12) GN=ybbA PE=3 SV=1 388 566 2.0E-16
sp|P0A9T9|YBBA_ECO57 Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli O157:H7 GN=ybbA PE=3 SV=1 388 566 2.0E-16
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 396 561 2.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 391 608 3.0E-16
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 387 566 3.0E-16
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 388 566 3.0E-16
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 371 613 4.0E-16
sp|Q8XDV7|PHNC_ECO57 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O157:H7 GN=phnC PE=3 SV=1 387 617 4.0E-16
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 396 552 5.0E-16
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 396 616 5.0E-16
sp|Q8YUV1|PHNC1_NOSS1 Phosphonates import ATP-binding protein PhnC 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC1 PE=3 SV=1 387 607 6.0E-16
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 388 566 8.0E-16
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 393 559 8.0E-16
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 391 582 9.0E-16
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 389 569 9.0E-16
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 396 633 9.0E-16
sp|Q9WXX8|Y124_THEMA Probable metal transport system ATP-binding protein TM_0124 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0124 PE=3 SV=1 395 599 1.0E-15
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 393 559 1.0E-15
sp|Q3YUN6|PHNC_SHISS Phosphonates import ATP-binding protein PhnC OS=Shigella sonnei (strain Ss046) GN=phnC PE=3 SV=1 387 617 1.0E-15
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 394 568 1.0E-15
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 394 600 1.0E-15
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 387 606 1.0E-15
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 394 600 1.0E-15
sp|Q0T9T7|PHNC_ECOL5 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=phnC PE=3 SV=1 387 617 1.0E-15
sp|Q8FAV1|PHNC_ECOL6 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=phnC PE=3 SV=1 387 617 1.0E-15
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 395 601 2.0E-15
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 403 582 2.0E-15
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 392 568 2.0E-15
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 378 552 2.0E-15
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 394 600 3.0E-15
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 383 603 3.0E-15
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 383 603 3.0E-15
sp|Q1R3F6|PHNC_ECOUT Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain UTI89 / UPEC) GN=phnC PE=3 SV=1 387 617 3.0E-15
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 383 552 3.0E-15
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 396 600 3.0E-15
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 393 566 3.0E-15
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 392 566 3.0E-15
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 405 606 3.0E-15
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 398 569 3.0E-15
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 392 617 4.0E-15
sp|P45092|ARTP_HAEIN Arginine transport ATP-binding protein ArtP OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=artP PE=3 SV=1 390 608 4.0E-15
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 388 639 4.0E-15
sp|Q5ZT78|LOLD_LEGPH Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lolD PE=3 SV=1 395 605 4.0E-15
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 387 567 4.0E-15
sp|Q5X2Z8|LOLD_LEGPA Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila (strain Paris) GN=lolD PE=3 SV=1 395 605 4.0E-15
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 392 617 4.0E-15
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 397 569 5.0E-15
sp|Q1BHS6|LOLD_BURCA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia cenocepacia (strain AU 1054) GN=lolD PE=3 SV=1 388 600 5.0E-15
sp|P16677|PHNC_ECOLI Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain K12) GN=phnC PE=3 SV=2 387 617 5.0E-15
sp|Q5LUD0|LOLD_RUEPO Lipoprotein-releasing system ATP-binding protein LolD OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lolD PE=3 SV=1 379 601 5.0E-15
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 391 581 6.0E-15
sp|Q83P97|PHNC_SHIFL Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri GN=phnC PE=3 SV=2 387 617 6.0E-15
sp|Q0SXV5|PHNC_SHIF8 Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri serotype 5b (strain 8401) GN=phnC PE=3 SV=1 387 617 6.0E-15
sp|Q8KF76|LOLD1_CHLTE Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lolD1 PE=3 SV=1 393 559 6.0E-15
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 389 569 6.0E-15
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 393 559 6.0E-15
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 384 552 7.0E-15
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 391 606 8.0E-15
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 393 559 8.0E-15
sp|Q7W148|PHNC_BORPA Phosphonates import ATP-binding protein PhnC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=phnC PE=3 SV=1 395 609 9.0E-15
sp|Q166X0|PHNC2_ROSDO Phosphonates import ATP-binding protein PhnC 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=phnC2 PE=3 SV=1 392 606 9.0E-15
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 403 658 9.0E-15
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 389 563 9.0E-15
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 396 571 9.0E-15
sp|Q31TP8|PHNC_SHIBS Phosphonates import ATP-binding protein PhnC OS=Shigella boydii serotype 4 (strain Sb227) GN=phnC PE=3 SV=1 387 617 9.0E-15
sp|Q3J7S3|LOLD_NITOC Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lolD PE=3 SV=1 395 600 1.0E-14
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 396 609 1.0E-14
sp|Q20ZP0|PHNC1_RHOPB Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC1 PE=3 SV=1 403 609 1.0E-14
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 395 616 1.0E-14
sp|Q329I3|PHNC_SHIDS Phosphonates import ATP-binding protein PhnC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=phnC PE=3 SV=1 387 617 1.0E-14
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 396 606 1.0E-14
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 403 581 1.0E-14
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 395 633 1.0E-14
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 396 571 1.0E-14
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 387 567 1.0E-14
sp|Q9HT73|ZNUC_PSEAE Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=znuC PE=3 SV=1 393 566 2.0E-14
sp|Q02DK9|ZNUC_PSEAB Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=znuC PE=3 SV=1 393 566 2.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 394 606 2.0E-14
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 393 554 2.0E-14
sp|Q39EV3|LOLD_BURL3 Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lolD PE=3 SV=1 388 600 2.0E-14
sp|Q5WUF8|LOLD_LEGPL Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila (strain Lens) GN=lolD PE=3 SV=1 395 605 2.0E-14
sp|Q1LPJ9|LOLD_CUPMC Lipoprotein-releasing system ATP-binding protein LolD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lolD PE=3 SV=1 388 601 2.0E-14
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 395 601 2.0E-14
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 396 612 2.0E-14
sp|Q7WNT8|PHNC_BORBR Phosphonates import ATP-binding protein PhnC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=phnC PE=3 SV=1 395 609 2.0E-14
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 395 552 2.0E-14
sp|Q87R20|LOLD_VIBPA Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lolD PE=3 SV=1 388 566 2.0E-14
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 384 566 2.0E-14
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 390 566 2.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 394 606 2.0E-14
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 396 558 2.0E-14
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 388 563 2.0E-14
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 384 569 3.0E-14
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 403 605 3.0E-14
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 379 612 3.0E-14
sp|Q28M30|LOLD_JANSC Lipoprotein-releasing system ATP-binding protein LolD OS=Jannaschia sp. (strain CCS1) GN=lolD PE=3 SV=1 384 600 3.0E-14
sp|Q6RCE0|PHNC_PSEST Phosphonates import ATP-binding protein PhnC OS=Pseudomonas stutzeri GN=phnC PE=3 SV=1 403 582 3.0E-14
sp|Q0VQQ0|LOLD_ALCBS Lipoprotein-releasing system ATP-binding protein LolD OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lolD PE=3 SV=2 388 592 3.0E-14
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 395 552 3.0E-14
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 393 554 3.0E-14
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 396 606 3.0E-14
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 390 566 3.0E-14
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 384 591 3.0E-14
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 390 582 4.0E-14
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 403 609 4.0E-14
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 396 608 4.0E-14
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 403 596 4.0E-14
sp|Q9RZU5|HMUV_DEIRA Hemin import ATP-binding protein HmuV OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hmuV PE=3 SV=1 393 603 4.0E-14
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 390 602 4.0E-14
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 392 609 4.0E-14
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 396 566 4.0E-14
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 392 569 4.0E-14
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 394 607 5.0E-14
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 384 552 5.0E-14
sp|Q5QU46|LOLD_IDILO Lipoprotein-releasing system ATP-binding protein LolD OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lolD PE=3 SV=1 389 600 5.0E-14
sp|Q11JI6|LOLD_CHESB Lipoprotein-releasing system ATP-binding protein LolD OS=Chelativorans sp. (strain BNC1) GN=lolD PE=3 SV=1 388 603 5.0E-14
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 388 566 5.0E-14
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 388 566 5.0E-14
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 388 566 5.0E-14
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 388 566 5.0E-14
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 389 569 5.0E-14
sp|Q98KS7|LOLD_RHILO Lipoprotein-releasing system ATP-binding protein LolD OS=Rhizobium loti (strain MAFF303099) GN=lolD PE=3 SV=2 388 563 5.0E-14
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 351 566 5.0E-14
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 392 636 5.0E-14
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 387 566 5.0E-14
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 380 571 5.0E-14
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 388 600 5.0E-14
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 395 596 5.0E-14
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 389 632 6.0E-14
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 396 600 6.0E-14
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 405 600 6.0E-14
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 392 607 6.0E-14
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 386 567 6.0E-14
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 365 552 7.0E-14
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 384 566 7.0E-14
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 395 618 8.0E-14
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 388 600 8.0E-14
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 396 606 8.0E-14
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 387 552 8.0E-14
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 396 563 8.0E-14
sp|Q2RU16|LOLD1_RHORT Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lolD1 PE=3 SV=2 393 600 8.0E-14
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 395 584 9.0E-14
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 384 552 9.0E-14
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 384 552 9.0E-14
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 390 566 9.0E-14
sp|Q9Z8J5|Y348_CHLPN Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 OS=Chlamydia pneumoniae GN=CPn_0348 PE=3 SV=1 379 599 9.0E-14
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 389 570 9.0E-14
sp|Q9CEW8|PSTB1_LACLA Phosphate import ATP-binding protein PstB 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pstB1 PE=3 SV=1 392 584 9.0E-14
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 394 600 9.0E-14
sp|Q8Y0C6|LOLD_RALSO Lipoprotein-releasing system ATP-binding protein LolD OS=Ralstonia solanacearum (strain GMI1000) GN=lolD PE=3 SV=1 388 601 9.0E-14
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 392 670 1.0E-13
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 391 584 1.0E-13
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 391 584 1.0E-13
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 383 623 1.0E-13
sp|P45127|ETTA_HAEIN Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1 405 569 1.0E-13
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 405 584 1.0E-13
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 405 584 1.0E-13
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 405 584 1.0E-13
sp|Q5LUR8|ZNUC_RUEPO Zinc import ATP-binding protein ZnuC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=znuC PE=3 SV=1 393 569 1.0E-13
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 392 624 1.0E-13
sp|Q28VN1|ZNUC_JANSC Zinc import ATP-binding protein ZnuC OS=Jannaschia sp. (strain CCS1) GN=znuC PE=3 SV=1 394 569 1.0E-13
sp|Q9AB70|PHNC_CAUCR Phosphonates import ATP-binding protein PhnC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=phnC PE=3 SV=1 384 616 1.0E-13
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 386 555 1.0E-13
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 388 600 1.0E-13
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 388 600 1.0E-13
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 384 553 1.0E-13
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 369 567 1.0E-13
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 388 601 1.0E-13
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 390 566 1.0E-13
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 384 592 1.0E-13
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 392 606 1.0E-13
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 388 600 1.0E-13
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 355 553 1.0E-13
sp|Q6D664|LOLD_PECAS Lipoprotein-releasing system ATP-binding protein LolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lolD PE=3 SV=1 395 566 1.0E-13
sp|Q16BC5|PHNC1_ROSDO Phosphonates import ATP-binding protein PhnC 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=phnC1 PE=3 SV=1 403 606 1.0E-13
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 393 625 1.0E-13
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 363 609 1.0E-13
sp|Q1B8U4|SSUB_MYCSS Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium sp. (strain MCS) GN=ssuB PE=3 SV=1 393 566 1.0E-13
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 392 612 1.0E-13
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 398 606 1.0E-13
sp|Q5E0B3|LOLD_VIBF1 Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lolD PE=3 SV=1 388 591 2.0E-13
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 385 567 2.0E-13
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 392 588 2.0E-13
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 394 601 2.0E-13
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 392 612 2.0E-13
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 402 641 2.0E-13
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 396 600 2.0E-13
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 388 588 2.0E-13
sp|Q9A9P4|LOLD1_CAUCR Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lolD1 PE=3 SV=1 389 566 2.0E-13
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 395 600 2.0E-13
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 396 571 2.0E-13
sp|Q4FTM3|LOLD_PSYA2 Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lolD PE=3 SV=1 388 601 2.0E-13
sp|Q3ATY5|LOLD1_CHLCH Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=lolD1 PE=3 SV=1 393 577 2.0E-13
sp|Q981Y8|SSUB2_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhizobium loti (strain MAFF303099) GN=ssuB2 PE=3 SV=1 384 600 2.0E-13
sp|A0L0V9|MACB_SHESA Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain ANA-3) GN=macB PE=3 SV=1 382 596 2.0E-13
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 411 571 2.0E-13
sp|Q87JM4|MACB_VIBPA Macrolide export ATP-binding/permease protein MacB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=macB PE=3 SV=1 389 568 2.0E-13
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 396 600 2.0E-13
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 396 565 2.0E-13
sp|Q3SRG8|LOLD_NITWN Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lolD PE=3 SV=1 387 603 2.0E-13
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 394 607 2.0E-13
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 390 563 2.0E-13
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 396 601 2.0E-13
sp|O31723|YLMA_BACSU Uncharacterized ABC transporter ATP-binding protein YlmA OS=Bacillus subtilis (strain 168) GN=ylmA PE=2 SV=2 395 606 2.0E-13
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 387 552 3.0E-13
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 393 601 3.0E-13
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 393 601 3.0E-13
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 393 601 3.0E-13
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 393 601 3.0E-13
sp|Q3AKM8|PHNC_SYNSC Phosphonates import ATP-binding protein PhnC OS=Synechococcus sp. (strain CC9605) GN=phnC PE=3 SV=1 384 600 3.0E-13
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 392 552 3.0E-13
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 392 552 3.0E-13
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 387 566 3.0E-13
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 380 563 3.0E-13
sp|Q6LTB1|ZNUC_PHOPR Zinc import ATP-binding protein ZnuC OS=Photobacterium profundum GN=znuC PE=3 SV=1 392 552 3.0E-13
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 395 617 3.0E-13
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 395 552 3.0E-13
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 405 599 3.0E-13
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 405 566 3.0E-13
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 396 600 3.0E-13
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 388 627 4.0E-13
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 391 584 4.0E-13
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 391 584 4.0E-13
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 387 565 4.0E-13
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 387 673 4.0E-13
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 396 563 4.0E-13
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 385 569 4.0E-13
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 385 569 4.0E-13
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 385 569 4.0E-13
sp|Q81TH8|POTA_BACAN Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus anthracis GN=potA PE=3 SV=2 393 601 4.0E-13
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 396 569 4.0E-13
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 396 569 4.0E-13
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 406 600 5.0E-13
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 384 552 5.0E-13
sp|Q1QLB0|LOLD_NITHX Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lolD PE=3 SV=1 387 603 5.0E-13
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 385 585 5.0E-13
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 382 639 5.0E-13
sp|Q1CI46|LOLD_YERPN Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lolD PE=3 SV=1 395 566 5.0E-13
sp|Q8ZFR4|LOLD_YERPE Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis GN=lolD PE=3 SV=1 395 566 5.0E-13
sp|Q1C6Q8|LOLD_YERPA Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lolD PE=3 SV=1 395 566 5.0E-13
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 384 552 5.0E-13
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 384 553 5.0E-13
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 391 582 6.0E-13
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 391 582 6.0E-13
sp|Q1QX72|LOLD_CHRSD Lipoprotein-releasing system ATP-binding protein LolD OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lolD PE=3 SV=2 388 600 6.0E-13
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 395 600 6.0E-13
sp|Q0HVQ0|LOLD_SHESR Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-7) GN=lolD PE=3 SV=2 395 601 6.0E-13
sp|A1RG29|MACB_SHESW Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain W3-18-1) GN=macB PE=3 SV=1 374 569 6.0E-13
sp|Q215F6|LOLD1_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD1 PE=3 SV=1 394 566 6.0E-13
sp|Q82CD3|SSUB2_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB2 PE=3 SV=1 392 566 6.0E-13
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 396 569 6.0E-13
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 396 569 6.0E-13
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 396 569 7.0E-13
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 389 626 7.0E-13
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 387 566 7.0E-13
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 396 571 7.0E-13
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 403 577 7.0E-13
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 393 600 7.0E-13
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 351 566 7.0E-13
sp|Q8YK28|PHNC3_NOSS1 Phosphonates import ATP-binding protein PhnC 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC3 PE=3 SV=1 396 609 7.0E-13
sp|Q39LW7|SSUB2_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB2 PE=3 SV=1 392 598 7.0E-13
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 396 569 7.0E-13
sp|Q74KF8|PSTB2_LACJO Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pstB2 PE=3 SV=1 396 569 7.0E-13
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 396 606 7.0E-13
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 389 626 8.0E-13
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 389 626 8.0E-13
sp|Q5GRS1|ZNUC_WOLTR Zinc import ATP-binding protein ZnuC OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=znuC PE=3 SV=1 393 604 8.0E-13
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 395 601 8.0E-13
sp|Q8EIL8|MACB_SHEON Macrolide export ATP-binding/permease protein MacB OS=Shewanella oneidensis (strain MR-1) GN=macB PE=3 SV=1 382 596 8.0E-13
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 393 601 8.0E-13
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 386 569 9.0E-13
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 387 600 9.0E-13
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 391 553 9.0E-13
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 351 566 9.0E-13
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 406 566 9.0E-13
sp|P57066|LOLD_VIBCH Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lolD PE=3 SV=1 388 566 1.0E-12
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 391 553 1.0E-12
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 389 601 1.0E-12
sp|Q2NU23|LOLD_SODGM Lipoprotein-releasing system ATP-binding protein LolD OS=Sodalis glossinidius (strain morsitans) GN=lolD PE=3 SV=1 395 592 1.0E-12
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 384 610 1.0E-12
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 406 600 1.0E-12
sp|Q2T4B3|MACB_BURTA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=macB PE=3 SV=1 403 566 1.0E-12
sp|Q8TI15|Y4342_METAC Putative ABC transporter ATP-binding protein MA_4342 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4342 PE=3 SV=1 392 624 1.0E-12
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 393 600 1.0E-12
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 395 569 1.0E-12
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 395 569 1.0E-12
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 395 569 1.0E-12
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 395 569 1.0E-12
sp|Q0BTP1|PSTB_GRABC Phosphate import ATP-binding protein PstB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pstB PE=3 SV=1 389 569 1.0E-12
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 396 607 1.0E-12
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 389 632 1.0E-12
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 394 569 1.0E-12
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 347 567 1.0E-12
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 384 553 1.0E-12
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 390 596 1.0E-12
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 404 566 1.0E-12
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 387 552 1.0E-12
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 393 566 1.0E-12
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 392 599 1.0E-12
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 395 600 1.0E-12
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 389 566 1.0E-12
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 390 566 1.0E-12
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 396 606 1.0E-12
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 394 601 1.0E-12
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 403 628 1.0E-12
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 391 553 1.0E-12
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 391 553 1.0E-12
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 395 600 1.0E-12
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 389 566 1.0E-12
sp|P0A9W5|ETTA_SHIFL Energy-dependent translational throttle protein EttA OS=Shigella flexneri GN=ettA PE=3 SV=2 405 569 1.0E-12
sp|P0A9W3|ETTA_ECOLI Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) GN=ettA PE=1 SV=2 405 569 1.0E-12
sp|P0A9W4|ETTA_ECO57 Energy-dependent translational throttle protein EttA OS=Escherichia coli O157:H7 GN=ettA PE=3 SV=2 405 569 1.0E-12
sp|Q57QD7|LOLD_SALCH Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella choleraesuis (strain SC-B67) GN=lolD PE=3 SV=1 388 566 1.0E-12
sp|Q0HJG0|LOLD_SHESM Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-4) GN=lolD PE=3 SV=2 395 601 1.0E-12
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 389 632 1.0E-12
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 395 600 2.0E-12
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 387 607 2.0E-12
sp|Q8UKE4|MACB_AGRFC Macrolide export ATP-binding/permease protein MacB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=macB PE=3 SV=1 403 600 2.0E-12
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 403 617 2.0E-12
sp|Q6MPX9|MACB_BDEBA Macrolide export ATP-binding/permease protein MacB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=macB PE=3 SV=1 389 595 2.0E-12
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 388 592 2.0E-12
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 406 609 2.0E-12
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 406 609 2.0E-12
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 406 609 2.0E-12
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 406 609 2.0E-12
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 387 569 2.0E-12
sp|Q3Z3Q4|MACB_SHISS Macrolide export ATP-binding/permease protein MacB OS=Shigella sonnei (strain Ss046) GN=macB PE=3 SV=1 389 632 2.0E-12
sp|P61482|LOLD_SALTY Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lolD PE=3 SV=1 388 566 2.0E-12
sp|P61481|LOLD_SALTI Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella typhi GN=lolD PE=3 SV=1 388 566 2.0E-12
sp|Q5PGR6|LOLD_SALPA Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lolD PE=3 SV=1 388 566 2.0E-12
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 395 600 2.0E-12
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 394 601 2.0E-12
sp|Q473H8|LOLD_CUPPJ Lipoprotein-releasing system ATP-binding protein LolD OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lolD PE=3 SV=1 388 601 2.0E-12
sp|Q66D26|PHNC_YERPS Phosphonates import ATP-binding protein PhnC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=phnC PE=3 SV=1 392 610 2.0E-12
sp|Q1CFV9|PHNC_YERPN Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=phnC PE=3 SV=2 392 610 2.0E-12
sp|Q8ZGU5|PHNC_YERPE Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis GN=phnC PE=3 SV=1 392 610 2.0E-12
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 396 555 2.0E-11
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 385 600 3.0E-11
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 403 556 4.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 391 555 7.0E-11
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 403 569 1.0E-10
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 392 563 2.0E-10
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 320 555 7.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 679 924 1.0E-09
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 403 552 5.0E-09
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 403 552 2.0E-08
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 403 563 6.0E-07
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 403 563 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 322 344 22
2 732 754 22
3 769 788 19
4 819 838 19
5 848 870 22
6 875 897 22
7 963 985 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|062850
MRALWVSFALGAFTWTTTYGQTCENYGSSNGSSCLCPTGFGGSSCSQPACGGNIFQGAQRPLVSVSSGFANLTSA
GCSCQSGWTGTGCNVCTSSNDCQAAFSSLDQSGDPTSAFGGQSLGNEDPLVCNTAPRVYAAGQLSCQVNNPTLQA
IYPLKSTLNIMRTRQPSLTPVPNVTAFGDTAEAYAQLFYDGVEQFYCHANSCTQEVDDSDGSAKWHCSNLRCTCR
PDTTFCGGVPVSDLTIPINGLVGDLDIECGAVDASTNLASCIFKQATLEQLFGPNGLPLDGCTFGECVRQSVIDN
GGNLTDTISDGNENGSSLNGGVIAGLAVVGGLVLLALLVLLWGLWAQRKARLSGLKDLDRRRVTLEWTNLTYIVP
GSYDRTFWSFGSKGGHEQTILNALTGRVEPGQMMAILGPSGAGKTTLVEILAGKNKSGTISGQVLTSPSYDLQGP
PRIGFVPQQDILPPMLTVFEALLFAARLRLPESIPDTEKQERAIALLERLGIESIRNARIGDNSGRKSRGISGGE
MRRVSIGLELIACPDILILDEPTSGLDSVSAARVARVLHEIAHDPVNPIPVIASIHQPSSQLYQQFDTVLLLSQG
HTLYSGAGSMAPVEHFNATNVAPPYLQGYNVADYLLEVASDPPVSLFDLSSSHKQLPRGSGSNCEVSEKGHSSLN
RDGEKKGNSEDLAIMNEQAATPHRTNGRTKNMYATTFLTQLQHLSGREWKILRRDKSLFITHTAVASVLGVFCGG
LYYQTDTSIAGFQSRVGCLFFLGALIAFSSLSALYNIVDIRPLFLRERSSAYYSPTSWLLSRFLFDMIPLRLIPT
IIVSSITYWMAGLAPHPPNFFKFLFVLVLYSMAMTLFNFLLGTLFQNGGIAILLSALSALYQMTFAGFFVHLNSI
PPVLRWLQWLCPLKYNLEALSVNEVGSGLLIQDTLEGVPVNVSASLIMNLLFGFGSNNYYRDILVLFAFIAGFGV
GVIGIVWFKVRERR*
Coding >Agabi119p4|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGGCAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAACATATTCCAAGGAGCCCAACGTCCATTAGTATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGAGTGGGTGGACCGGGACTGGTTGCAATGTATGCACCAGTTCCAATGACTGTCAAGCTGCC
TTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCATTAGGGAATGAAGATCCTCTG
GTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTTAATAATCCCACCCTTCAAGCC
ATATACCCACTGAAGTCCACCCTCAACATCATGCGCACTCGCCAACCCAGTTTGACGCCTGTGCCAAACGTAACC
GCGTTCGGAGATACAGCGGAAGCTTATGCACAGCTGTTCTATGACGGTGTAGAGCAGTTCTACTGCCATGCAAAT
TCATGCACTCAAGAAGTCGACGACTCGGACGGTAGTGCCAAGTGGCATTGTAGTAACCTTCGATGTACTTGTCGC
CCAGATACGACTTTTTGTGGCGGCGTACCGGTCAGCGACCTTACCATTCCCATCAACGGACTGGTTGGCGATCTC
GATATCGAATGTGGGGCTGTCGACGCCTCCACCAATCTGGCATCTTGCATATTCAAACAGGCGACTCTCGAACAG
TTGTTTGGTCCTAATGGACTTCCACTTGACGGATGCACGTTCGGGGAATGCGTGAGGCAGAGCGTCATTGACAAT
GGTGGAAATTTGACGGATACCATAAGTGACGGGAATGAGAACGGTTCAAGTCTCAACGGTGGTGTTATTGCTGGC
CTGGCTGTTGTAGGGGGATTGGTTCTCCTAGCTTTGCTTGTACTTCTTTGGGGGCTTTGGGCACAAAGGAAAGCA
AGGCTTTCGGGCTTGAAGGATTTGGACAGGCGAAGGGTCACATTGGAATGGACGAACCTCACTTACATCGTACCT
GGATCTTATGACCGCACTTTCTGGAGCTTTGGGAGCAAAGGTGGACATGAGCAAACAATTCTCAATGCCCTCACA
GGTCGTGTGGAACCCGGACAAATGATGGCCATTCTGGGACCAAGTGGCGCCGGAAAGACTACTTTAGTTGAAATT
CTAGCGGGGAAGAATAAATCCGGAACAATATCTGGTCAGGTTTTGACCTCACCGAGTTATGATCTTCAAGGACCT
CCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTACCTCCAATGCTAACGGTGTTCGAAGCGCTTCTCTTTGCA
GCGCGTTTGCGACTACCCGAAAGTATACCCGATACGGAGAAGCAAGAACGTGCGATTGCATTATTAGAAAGGCTC
GGGATCGAAAGTATTAGAAACGCGCGCATTGGGGATAATTCTGGAAGAAAGTCTCGCGGGATAAGCGGAGGGGAG
ATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCTTGCCCTGATATTCTAATCCTTGATGAACCCACTTCTGGA
CTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCATGACCCAGTGAATCCTATACCC
GTCATTGCCTCTATCCACCAACCCAGCTCACAGTTATACCAACAATTTGACACCGTCTTACTTCTCTCTCAAGGA
CATACCCTCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAACGCAACAAACGTCGCACCTCCCTAC
CTCCAGGGCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCGGTCAGCCTCTTTGACTTATCA
TCATCACACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAAAAAGGACACAGTTCGTTAAAC
CGCGATGGCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAAGCTGCTACTCCGCATCGGACG
AATGGGAGGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCATCTATCAGGAAGAGAATGGAAG
ATTTTGCGAAGGGACAAGTCGTTGTTCATTACTCATACAGCGGTGGCGAGTGTCCTTGGCGTTTTTTGTGGTGGT
TTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGTGCCTGTTCTTCTTGGGCGCTCTC
ATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTCTTTCTTCGTGAGCGTTCTAGC
GCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATACCACTTCGGCTTATTCCAACT
ATAATCGTTTCCTCCATAACTTACTGGATGGCAGGGTTAGCTCCACATCCCCCGAATTTCTTCAAATTTCTCTTT
GTCTTGGTGCTTTACAGTATGGCTATGACGCTTTTCAACTTTTTGCTTGGTACATTATTCCAGAATGGGGGCATT
GCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGATGACATTCGCAGGCTTCTTTGTGCACCTCAACTCTATA
CCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCTGAAGTATAACCTCGAGGCGCTGTCTGTCAATGAAGTT
GGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGTACCGGTGAACGTTTCGGCGAGTCTGATCATGAATTTG
CTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATTCTTGTTCTATTTGCTTTCATTGCTGGCTTCGGTGTT
GGCGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA
Transcript >Agabi119p4|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGGCAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAACATATTCCAAGGAGCCCAACGTCCATTAGTATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGAGTGGGTGGACCGGGACTGGTTGCAATGTATGCACCAGTTCCAATGACTGTCAAGCTGCC
TTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCATTAGGGAATGAAGATCCTCTG
GTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTTAATAATCCCACCCTTCAAGCC
ATATACCCACTGAAGTCCACCCTCAACATCATGCGCACTCGCCAACCCAGTTTGACGCCTGTGCCAAACGTAACC
GCGTTCGGAGATACAGCGGAAGCTTATGCACAGCTGTTCTATGACGGTGTAGAGCAGTTCTACTGCCATGCAAAT
TCATGCACTCAAGAAGTCGACGACTCGGACGGTAGTGCCAAGTGGCATTGTAGTAACCTTCGATGTACTTGTCGC
CCAGATACGACTTTTTGTGGCGGCGTACCGGTCAGCGACCTTACCATTCCCATCAACGGACTGGTTGGCGATCTC
GATATCGAATGTGGGGCTGTCGACGCCTCCACCAATCTGGCATCTTGCATATTCAAACAGGCGACTCTCGAACAG
TTGTTTGGTCCTAATGGACTTCCACTTGACGGATGCACGTTCGGGGAATGCGTGAGGCAGAGCGTCATTGACAAT
GGTGGAAATTTGACGGATACCATAAGTGACGGGAATGAGAACGGTTCAAGTCTCAACGGTGGTGTTATTGCTGGC
CTGGCTGTTGTAGGGGGATTGGTTCTCCTAGCTTTGCTTGTACTTCTTTGGGGGCTTTGGGCACAAAGGAAAGCA
AGGCTTTCGGGCTTGAAGGATTTGGACAGGCGAAGGGTCACATTGGAATGGACGAACCTCACTTACATCGTACCT
GGATCTTATGACCGCACTTTCTGGAGCTTTGGGAGCAAAGGTGGACATGAGCAAACAATTCTCAATGCCCTCACA
GGTCGTGTGGAACCCGGACAAATGATGGCCATTCTGGGACCAAGTGGCGCCGGAAAGACTACTTTAGTTGAAATT
CTAGCGGGGAAGAATAAATCCGGAACAATATCTGGTCAGGTTTTGACCTCACCGAGTTATGATCTTCAAGGACCT
CCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTACCTCCAATGCTAACGGTGTTCGAAGCGCTTCTCTTTGCA
GCGCGTTTGCGACTACCCGAAAGTATACCCGATACGGAGAAGCAAGAACGTGCGATTGCATTATTAGAAAGGCTC
GGGATCGAAAGTATTAGAAACGCGCGCATTGGGGATAATTCTGGAAGAAAGTCTCGCGGGATAAGCGGAGGGGAG
ATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCTTGCCCTGATATTCTAATCCTTGATGAACCCACTTCTGGA
CTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCATGACCCAGTGAATCCTATACCC
GTCATTGCCTCTATCCACCAACCCAGCTCACAGTTATACCAACAATTTGACACCGTCTTACTTCTCTCTCAAGGA
CATACCCTCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAACGCAACAAACGTCGCACCTCCCTAC
CTCCAGGGCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCGGTCAGCCTCTTTGACTTATCA
TCATCACACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAAAAAGGACACAGTTCGTTAAAC
CGCGATGGCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAAGCTGCTACTCCGCATCGGACG
AATGGGAGGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCATCTATCAGGAAGAGAATGGAAG
ATTTTGCGAAGGGACAAGTCGTTGTTCATTACTCATACAGCGGTGGCGAGTGTCCTTGGCGTTTTTTGTGGTGGT
TTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGTGCCTGTTCTTCTTGGGCGCTCTC
ATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTCTTTCTTCGTGAGCGTTCTAGC
GCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATACCACTTCGGCTTATTCCAACT
ATAATCGTTTCCTCCATAACTTACTGGATGGCAGGGTTAGCTCCACATCCCCCGAATTTCTTCAAATTTCTCTTT
GTCTTGGTGCTTTACAGTATGGCTATGACGCTTTTCAACTTTTTGCTTGGTACATTATTCCAGAATGGGGGCATT
GCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGATGACATTCGCAGGCTTCTTTGTGCACCTCAACTCTATA
CCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCTGAAGTATAACCTCGAGGCGCTGTCTGTCAATGAAGTT
GGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGTACCGGTGAACGTTTCGGCGAGTCTGATCATGAATTTG
CTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATTCTTGTTCTATTTGCTTTCATTGCTGGCTTCGGTGTT
GGCGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA
Gene >Agabi119p4|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGGCAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAACATATTCCAAGGAGCCCAACGTCCATTAGTATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGAGTGGGTGGACCGGGACTGGTTGCAATGTATGCACCAGTTCCAATGACTGTCAAGCTGCC
TTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCATTAGGGAATGAAGATCCTCTG
GTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTTAATGTACGTATCTGGTCATTT
TCTTCGAGTGTTTCTCATGGATAAGCTTTAGAATCCCACCCTTCAAGCCATATACCCACTGAAGTCCACCCTCAA
CATCATGCGCACTCGCCAACCCAGTTTGACGCCTGTGCCAAACGTAACCGCGTTCGGAGATACAGCGGAAGCTTA
TGCACAGCTGTTCTATGACGGTGTAGAGCAGTTCTACTGCCATGCAAATTCATGCACTCAAGAAGTCGACGACTC
GGACGGTAGTGCCAAGTGGCATTGTAGTAACCTTCGATGTACTTGTCGCCCAGATACGACTTTTTGTGGCGGCGT
ACCGGTCAGCGACCTTACCATTCCCATCAACGGACTGGTTGGCGATCTCGATATCGAATGTGGGGCTGTCGACGC
CTCCACCAATCTGGCATCTTGCATATTCAAACAGGCGACTCTCGAACAGTTGTTTGGTCCTAATGGACTTCCACT
TGACGGATGCACGTTCGGGGAATGCGTGAGGCAGAGCGTCATTGACAATGGTGGAAATTTGACGGATACCATAAG
TGACGGGAATGAGAACGGTTCAAGTCTCAACGGTGGTGTTATTGCTGGCCTGGCTGTTGTAGGGGGATTGGTTCT
CCTAGCTTTGCTTGTACTTCTTTGGGGGCTTTGGGCACAAAGGAAAGCAAGGCTTTCGGGCTTGAAGGATTTGGA
CAGGCGAAGGGTCACATTGGAATGGACGAACCTCACTTACATCGTACCTGGATCTTATGACCGCACTTTCTGGAG
CTTTGGGAGCAAAGGTGGACATGAGCAAACAATTCTCAATGCCCTCACAGGTCGTGTGGAACCCGGACAAATGAT
GGCCATTCTGGGACCAAGTGGCAAGTACCCTGTACCCTTCGACACGTCGCGCTATAGTGTTGCTGACCATGCCAA
TATGGTTTAGGCGCCGGAAAGACTACTTTAGTTGAAATTCTAGCGGGGAAGAATAAATCCGGAACAATATCTGGT
CAGGTTTTGACCTCACCGAGTTATGATCTTCAAGGACCTCCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTA
CCTCCAATGCTAACGGTGTTCGAAGCGCTTCTCTTTGCAGCGCGTTTGCGACTACCCGAAAGTATACCCGATACG
GAGAAGCAAGAACGTGCGATTGCATTATTAGAAAGGCTCGGGATCGAAAGTATTAGAAACGCGCGCATTGGGGAT
AATTCTGGAAGAAAGTCTCGCGGGATAAGCGGAGGGGAGATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCT
TGCCCTGATATTCTAATCCTTGATGAACCCACTTCTGGTCGGTGCTCATTCGTGTAAGTAAGATCGTTACTGACT
TATTTTCTCTAGGACTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCATGACCCAG
TGAATCCTATACCCGTCATTGCCTCTATCCACCAACCCAGGTATGTAGGGCTCTTGAATTTATGTTCAGCAGGTT
TACTGATACCACATCTCAGCTCACAGTTATACCAACAATTTGACACCGTCTTACTTCTCTCTCAAGGACATACCC
TCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAACGCAACAAACGTCGCACCTCCCTACCTCCAGG
GCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCGGTCAGCCTCTTTGACTTATCATCATCAC
ACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAAAAAGGACACAGTTCGTTAAACCGCGATG
GCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAAGCTGCTACTCCGCATCGGACGAATGGGA
GGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCATCTATCAGGAAGAGAATGGAAGATTTTGC
GAAGGTGCTCCTTGTTTGTTCTTTTTCCTTGTGTCCGTCTAACGTGGCGAATCTAGGGACAAGTCGTTGTTCATT
ACTCATACAGCGGTGGCGAGTGTCCTTGGCGTTTTTTGTGGTGAGCATACTCGTTCAGTTCCTGGGATATAACGA
TGCCAAGCCGATTTCCAGGTGGTTTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGT
GCCTGTTCTTCTTGGCAAGTCGACGCTTTCATCTTTCGCGAATGTTGGGAAGTTAATTGATTTCTAGGGCGCTCT
CATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTCTTTCTTCGTGAGCGTTCTAG
CGCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATACCACTTCGGCTTATTCCAAC
TATAATCGTTTCCTCCATGTAAGGCCTTTCAAAGTTTTCCACAGGGCGAATCTGAACTGATGAAATGATAGAACT
TACTGGATGGCAGGGTTAGCTCCACATCCCCCGAATTTCTTCAAATTTCTCTTTGTCTTGGTGCTTTACAGTATG
GCTATGACGCTTTTCGTAAGTTATTCATCAGAGTGGAATCCGAGCCTTTTTACTGATATCAGTCCAAATATAGAA
CTTTTTGCTTGGTACATTATTCCAGAATGGGGGCATTGCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGAT
GACATTCGCAGGCTTCTTTGTGCACCTCAACTCTATACCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCT
GAAGTATAACCTCGAGGCGCTGTCTGTCAATGAAGTTGGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGT
ACCGGTGAACGTTTCGGCGAGTCTGATCATGAATTTGGTATGTCACACATTTTTCCGCGAATTTCTTGAGGATAT
CCGTTGATGAGATTCCATAGCTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATTCTTGTTCTATTTGCTT
TCATTGCTGGCTTCGGTGTTGGCGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail