Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|062660
Gene name
Locationscaffold_03b:547157..548781
Strand-
Gene length (bp)1624
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9RC92|UGL_BACGL Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) GN=ugl PE=1 SV=1 59 381 8.0E-30
sp|Q8DR77|UCDH_STRR6 Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ugl PE=1 SV=1 64 381 5.0E-29
sp|Q8E372|UCDH_STRA3 Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1889 PE=1 SV=1 64 381 2.0E-28
sp|Q9A0T3|UCDH_STRP1 Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 GN=ugl PE=1 SV=1 118 381 2.0E-26

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|062660
MKAVVALGILAPSVLAATVPNELFSSLVPQKILATFNDLPNPTQYPQYTDQRAGDWQYFNPNTWTSGFFPSTLYA
LNTRRTLCGATSRNGLGIANWLELGREASRALIPLETKNSQGHDVGFLSFPFVEELAVNPNSETAVTAINSFAKL
LANRFNPTVGCTRSWDAPDPDFQVIIDNMMNLEVLFHSAELTNNDTLRTIGKKHADTTMINHIRQDGGTWHVLHY
NTFTGAVTAKRTAQGFADSSTWSRGQAWGIYGYATMFKLTGKAEYRDTAVRLADYFLDHIPNDGIVPWDFNAPSP
KPADSSAATIAANALLLLSQLETTPSLKERFSNAAIELLEKITELAWNPSWQSLLSNGTVNAPARNQLTGTVYGD
YYFVKAGNELISMGLASCT*
Coding >Agabi119p4|062660
ATGAAAGCTGTGGTCGCCCTTGGTATTCTAGCCCCGTCAGTCCTCGCGGCTACAGTCCCCAACGAACTCTTCTCA
TCCCTCGTCCCTCAAAAAATCCTCGCAACCTTCAATGACCTACCCAATCCTACGCAATACCCTCAATACACCGAC
CAACGAGCTGGCGATTGGCAATACTTCAATCCCAACACATGGACATCAGGTTTCTTCCCCTCCACACTTTACGCC
TTAAACACGAGGCGCACATTGTGCGGTGCCACATCACGAAATGGGTTAGGAATTGCTAATTGGTTGGAGTTGGGG
AGAGAGGCGAGTAGGGCGTTGATACCTCTTGAGACTAAGAATTCTCAGGGACATGATGTTGGATTTTTGAGTTTT
CCGTTTGTTGAGGAGTTGGCTGTAAATCCGAACAGTGAGACGGCTGTTACTGCGATAAACAGCTTTGCCAAGTTA
CTTGCCAATCGGTTTAATCCTACTGTTGGGTGTACAAGAAGTTGGGACGCGCCTGATCCTGATTTCCAGGTCATC
ATCGATAACATGATGAACCTTGAAGTTCTATTCCATTCCGCCGAATTAACTAACAACGACACGTTGCGTACGATT
GGCAAAAAACACGCGGATACTACTATGATAAACCATATCCGACAAGACGGAGGGACTTGGCATGTCCTTCATTAT
AACACGTTTACTGGTGCTGTTACTGCCAAGAGGACGGCTCAGGGATTTGCGGATAGCAGCACGTGGTCGCGTGGT
CAGGCTTGGGGTATTTATGGTTACGCCACTATGTTTAAATTGACGGGTAAGGCCGAATATCGTGATACTGCGGTC
CGTTTAGCGGATTATTTCCTTGACCATATTCCTAATGATGGAATTGTACCATGGGATTTCAATGCTCCGTCTCCA
AAGCCAGCAGATTCTTCAGCAGCAACTATCGCTGCTAATGCTCTTCTTCTCCTCTCACAACTCGAAACGACACCT
AGTCTAAAAGAGAGATTCAGTAATGCTGCCATCGAGTTATTGGAAAAAATCACTGAATTGGCTTGGAATCCGTCG
TGGCAGAGTTTATTGTCGAATGGGACAGTGAATGCGCCTGCTCGGAATCAACTTACGGGTACTGTTTATGGAGAT
TATTATTTCGTCAAGGCTGGGAATGAATTGATATCTATGGGTTTGGCATCGTGTACTTGA
Transcript >Agabi119p4|062660
ATGAAAGCTGTGGTCGCCCTTGGTATTCTAGCCCCGTCAGTCCTCGCGGCTACAGTCCCCAACGAACTCTTCTCA
TCCCTCGTCCCTCAAAAAATCCTCGCAACCTTCAATGACCTACCCAATCCTACGCAATACCCTCAATACACCGAC
CAACGAGCTGGCGATTGGCAATACTTCAATCCCAACACATGGACATCAGGTTTCTTCCCCTCCACACTTTACGCC
TTAAACACGAGGCGCACATTGTGCGGTGCCACATCACGAAATGGGTTAGGAATTGCTAATTGGTTGGAGTTGGGG
AGAGAGGCGAGTAGGGCGTTGATACCTCTTGAGACTAAGAATTCTCAGGGACATGATGTTGGATTTTTGAGTTTT
CCGTTTGTTGAGGAGTTGGCTGTAAATCCGAACAGTGAGACGGCTGTTACTGCGATAAACAGCTTTGCCAAGTTA
CTTGCCAATCGGTTTAATCCTACTGTTGGGTGTACAAGAAGTTGGGACGCGCCTGATCCTGATTTCCAGGTCATC
ATCGATAACATGATGAACCTTGAAGTTCTATTCCATTCCGCCGAATTAACTAACAACGACACGTTGCGTACGATT
GGCAAAAAACACGCGGATACTACTATGATAAACCATATCCGACAAGACGGAGGGACTTGGCATGTCCTTCATTAT
AACACGTTTACTGGTGCTGTTACTGCCAAGAGGACGGCTCAGGGATTTGCGGATAGCAGCACGTGGTCGCGTGGT
CAGGCTTGGGGTATTTATGGTTACGCCACTATGTTTAAATTGACGGGTAAGGCCGAATATCGTGATACTGCGGTC
CGTTTAGCGGATTATTTCCTTGACCATATTCCTAATGATGGAATTGTACCATGGGATTTCAATGCTCCGTCTCCA
AAGCCAGCAGATTCTTCAGCAGCAACTATCGCTGCTAATGCTCTTCTTCTCCTCTCACAACTCGAAACGACACCT
AGTCTAAAAGAGAGATTCAGTAATGCTGCCATCGAGTTATTGGAAAAAATCACTGAATTGGCTTGGAATCCGTCG
TGGCAGAGTTTATTGTCGAATGGGACAGTGAATGCGCCTGCTCGGAATCAACTTACGGGTACTGTTTATGGAGAT
TATTATTTCGTCAAGGCTGGGAATGAATTGATATCTATGGGTTTGGCATCGTGTACTTGA
Gene >Agabi119p4|062660
ATGAAAGCTGTGGTCGCCCTTGGTATTCTAGCCCCGTCAGTCCTCGCGGCTACAGTCCCCAACGAACTCTTCTCA
TCCCTCGTCCCTCAAAAAATCCTCGCAACCTTCAATGACCTACCCAATCCTACGCAATACCCTCAATACACCGAC
CAACGAGCTGGCGATTGGCAATACTTCAATCCCAACACATGGACATCAGGTTTCTTCCCCTCCACACTTTACGCC
TTAAACACGAGGCGCACATTGTGCGGTGCCACATCACGAAATGGGTTAGGAATTGCTAATTGGTTGGAGTTGGGG
AGAGAGGCGAGTAGGGCGTTGATACCTCTTGAGACTAAGAATTCTCAGGGACATGATGTTGGATTTTTGAGTTTT
CCGTTTGTTGAGGAGTTGGCTGTGTAAGTTAAAATTATTACCTTGTCAGGAAATTATTCACGCGTGATTGATTGG
TTCAATTTTCCAGAAATCCGAACAGTGAGACGGCTGTTACTGCGATAAACAGCTTTGCCAAGTTACTTGCCAATC
GGTTTAATCCTACTGTTGGGTGTACAAGAAGTTGGGACGCGCCTGATCCTGATTTCCAGGTGCGTACGTCACATA
TAAATATCTTAGATCTAGAATCTCAACACCAAGTTCTATAAACGTGGAATTCGACAACAGGTCATCATCGATAAC
ATGATGAACCTTGAAGTTCTATTCCATTCCGCCGAATTAACTAACAACGACACGTTGCGTACGATTGGCAAAAAA
CACGCGGATACTACTATGATAAACCATATCCGACAAGACGGAGGGACTTGGCATGTCCTTCATTATAACACGTTT
ACTGGTGCTGTTACTGCCAAGAGGACGGCTCAGGGATTTGCGGATAGCAGGTACGCTTCACGCGACACACTTTCT
CTAAAGGCTTTTCACTTACTCAATCTTTCTTAGCACGTGGTCGCGTGGTCAGGCTTGGGGTATTTATGGTTACGC
CACTAGTGAGTTTGTTATATACATTTCAAATTTTTAGTTTTTTCTTAGAACGCTTCGACAGTGTTTAAATTGACG
GGTAAGGCCGAATATCGTGATACTGCGGTCCGTTTAGCGGATTATTTCCTTGACCATATTCCTAATGATGGAATT
GTACCATGGTAAGCGTCCCTTTGAGTATTTTGATGATTGAATTCCATTTTGATAATGCCTAGGGATTTCAATGCT
CCGTCTCCAAAGCCAGCAGATTCTTCAGCAGCAACTATCGCTGCTAATGCTCTTCTTCTCCTCTCACAACTCGAA
ACGACACCTAGTCTAAAAGAGAGATTCAGTAATGCTGCCATCGAGGTACGTTTCTCCGTTTTTTTTTTTCGCAAT
TACCAGAGAGATTTTAAAAAAAATTGAATTGCTACTTTAACAGTTATTGGAAAAAATCACTGAATTGGCTTGGAA
TCCGTCGTGGCAGAGTTTATTGTCGAATGGGACAGTGAATGCGCCTGCTCGGAATCAACTTACGGGTACTGTTTA
TGGTTCGTTTCTAAATAATCAACTAACTACTTTGAGTGATGCTGATTTATTTACTTTAGGAGATTATTATTTCGT
CAAGGCTGGGAATGAATTGATATCTATGGGTTTGGCATCGTGTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail