Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|062210
Gene name
Locationscaffold_03b:434188..436879
Strand-
Gene length (bp)2691
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05208 ALG3 ALG3 protein 4.9E-32 31 120
PF05208 ALG3 ALG3 protein 6.3E-92 117 366
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 9.4E-08 568 662

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN93|ALG3_CRYNB Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG3 PE=3 SV=1 7 397 8.0E-90
sp|P0CN92|ALG3_CRYNJ Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG3 PE=3 SV=1 7 397 9.0E-90
sp|Q55F69|ALG3_DICDI Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum GN=alg3 PE=3 SV=1 22 382 5.0E-86
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 14 403 1.0E-79
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 35 399 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN93|ALG3_CRYNB Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG3 PE=3 SV=1 7 397 8.0E-90
sp|P0CN92|ALG3_CRYNJ Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG3 PE=3 SV=1 7 397 9.0E-90
sp|Q55F69|ALG3_DICDI Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum GN=alg3 PE=3 SV=1 22 382 5.0E-86
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 14 403 1.0E-79
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 35 399 2.0E-78
sp|O82244|ALG3_ARATH Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana GN=ALG3 PE=1 SV=1 31 383 7.0E-78
sp|Q92685|ALG3_HUMAN Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens GN=ALG3 PE=1 SV=1 7 394 3.0E-73
sp|Q8K2A8|ALG3_MOUSE Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus GN=Alg3 PE=1 SV=2 17 392 9.0E-71
sp|A1DDZ3|ALG3_NEOFI Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alg3 PE=3 SV=1 14 380 2.0E-70
sp|Q6CMF1|ALG3_KLULA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG3 PE=3 SV=1 36 400 3.0E-70
sp|A1CBE6|ALG3_ASPCL Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alg3 PE=3 SV=1 13 380 4.0E-70
sp|Q4WVG2|ALG3_ASPFU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg3 PE=3 SV=1 14 380 2.0E-69
sp|Q9Y7I4|ALG3_SCHPO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg3 PE=3 SV=1 23 366 3.0E-69
sp|A3LTB7|ALG3_PICST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ALG3 PE=3 SV=2 37 381 1.0E-66
sp|Q6FXS2|ALG3_CANGA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG3 PE=3 SV=1 35 377 3.0E-65
sp|Q751K5|ALG3_ASHGO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG3 PE=3 SV=2 35 367 7.0E-65
sp|P38179|ALG3_YEAST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG3 PE=1 SV=1 14 366 3.0E-62
sp|Q6BYY8|ALG3_DEBHA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG3 PE=3 SV=1 7 383 8.0E-62
sp|Q6DNA2|ALG3_PICPG Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ALG3 PE=3 SV=2 12 367 5.0E-60
sp|A2RA94|ALG3_ASPNC Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=alg3 PE=3 SV=1 13 366 3.0E-59
sp|A5DJQ5|ALG3_PICGU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ALG3 PE=3 SV=2 37 381 2.0E-56
sp|Q0TVF9|ALG3_PHANO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ALG3 PE=3 SV=2 14 271 3.0E-54
sp|P82149|NT53_DROME Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster GN=l(2)not2 PE=2 SV=1 15 269 6.0E-44
sp|Q27333|NT56_DROME Lethal(2)neighbour of tid protein OS=Drosophila melanogaster GN=l(2)not PE=1 SV=1 15 269 2.0E-43
sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protein OS=Drosophila virilis GN=l(2)not PE=1 SV=1 11 249 3.0E-41
sp|Q27333|NT56_DROME Lethal(2)neighbour of tid protein OS=Drosophila melanogaster GN=l(2)not PE=1 SV=1 305 380 2.0E-15
sp|P82149|NT53_DROME Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster GN=l(2)not2 PE=2 SV=1 305 369 3.0E-14
sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protein OS=Drosophila virilis GN=l(2)not PE=1 SV=1 306 380 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0016758 hexosyltransferase activity No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 68 90 22
3 105 122 17
4 129 151 22
5 161 183 22
6 245 267 22
7 300 319 19
8 340 357 17
9 367 384 17
10 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|062210
MANASPLHHVYSLVKSLLLDRRYFWTLASFVLIGDVVLTEIIIKFISYTEIDWETYMIQTELYIKGQYNYSLISG
PTGPLVYPAGHVRIHEYLYRFTNAGRDIRFAQHIYGILYILTLTVIKRLHSIFVLRLFNDCWALFLMALSILAYQ
FNLDDTGILFYGLALSVKMSILLYLPGLLVIIFKRRGLVTTLRQLLTVIAIQALLASPFISEDPWSYLKGAFDLG
RVFLYKWTVNWRFVDEGTFLNPTFALSLLVGHISALVAFGLFKWCKLDGGVWKVLDRGLRRPRHPAGLAPTNPDY
TATVLFTSNLIGILFARSLHYQFYSWYSMQIPFLAWRTRYPIILKLALLLMIEYAWNVYPSTDLSSAALLAGNSL
LLIGVWFGYPNGVTTSQAASTQRKANHHQPSIFGHFLLALLNSLLVCTNTMPKKKAATSKSKSDIPSTTTKASIA
PVTASMVFPDLAPKQGLECRTILEDQILVIDEFLSPAECKIYAKFIDNLPLELTPPKKRGEAERVNYRFSVASLD
FAQRLHTLLTPHLPSFPYPSWSKKKTDTDEPRLPHSFNSNIRMYKYCEGQYFGPHYDDSVKDTLTGVKSEWTLLI
YLSGIEDGVEGGETVFYREERGKPRESIVPQLNRGTALLHRHGQNCMLHEGSPVKSGTKYVLRSDLMFMG*
Coding >Agabi119p4|062210
ATGGCTAACGCGTCTCCCTTGCACCATGTCTACAGTCTGGTCAAGTCTCTGCTATTGGACCGACGCTACTTCTGG
ACGTTGGCGAGCTTCGTTCTCATAGGGGATGTGGTCCTCACGGAAATCATCATCAAGTTCATTTCTTACACAGAA
ATTGATTGGGAGACCTACATGATCCAAACGGAACTTTATATCAAAGGGCAATATAACTACTCTTTGATATCAGGA
CCCACGGGACCACTGGTGTACCCCGCTGGTCACGTCAGGATTCATGAATACTTGTATAGATTCACAAACGCAGGT
CGCGACATTCGATTTGCACAACACATCTATGGTATTTTGTATATCCTTACCCTAACGGTGATCAAACGTCTGCAT
TCCATATTTGTCCTTAGGCTGTTCAATGACTGCTGGGCTCTCTTTTTAATGGCTTTGTCGATATTGGCGTATCAG
TTCAATCTCGATGATACTGGTATACTATTCTATGGCCTTGCCCTTTCTGTTAAAATGTCGATTCTACTATACCTT
CCCGGTCTTCTGGTTATTATTTTCAAACGTCGCGGACTTGTGACAACACTTCGTCAGCTGCTCACCGTCATAGCA
ATCCAAGCGCTACTTGCCTCCCCATTTATTTCTGAAGACCCATGGAGCTACTTGAAAGGTGCCTTTGACCTAGGC
CGTGTATTTCTGTATAAATGGACTGTGAACTGGAGATTTGTCGACGAGGGAACGTTTTTGAACCCGACTTTCGCT
CTGAGTTTACTCGTGGGGCATATTTCCGCGTTGGTGGCTTTTGGGTTGTTCAAATGGTGTAAATTGGATGGAGGT
GTTTGGAAGGTTTTGGATCGGGGATTAAGACGACCGCGTCATCCTGCTGGACTTGCTCCGACCAATCCCGATTAC
ACCGCTACCGTCTTATTCACTTCCAATCTGATTGGCATTCTTTTTGCGCGGTCATTGCATTACCAGTTTTACTCC
TGGTATTCAATGCAAATACCTTTTTTGGCTTGGAGGACACGATATCCGATTATACTGAAGCTTGCTCTTCTTCTC
ATGATTGAATACGCGTGGAATGTCTATCCTTCCACCGATCTTTCGTCTGCGGCTCTCTTGGCTGGAAATTCATTG
TTACTTATTGGAGTATGGTTTGGATATCCAAATGGTGTAACTACGAGTCAAGCCGCGTCTACCCAGCGTAAGGCT
AACCATCACCAGCCATCAATCTTTGGTCATTTCCTTCTTGCCTTGCTTAACTCACTACTCGTTTGTACCAATACC
ATGCCTAAGAAAAAAGCGGCGACTTCTAAATCTAAATCTGATATTCCTTCGACTACAACAAAGGCATCTATTGCC
CCAGTAACAGCCTCCATGGTGTTTCCAGATCTGGCTCCGAAACAAGGACTTGAATGCCGGACCATCCTTGAAGAT
CAAATTCTAGTCATCGACGAATTCTTATCTCCAGCAGAATGCAAGATCTACGCCAAATTCATTGATAATCTCCCA
CTTGAGCTCACTCCACCGAAGAAAAGAGGGGAGGCGGAACGAGTTAATTACAGGTTTTCTGTTGCGTCTTTGGAT
TTCGCTCAGAGGTTGCATACCCTCCTGACGCCTCATTTACCGTCATTTCCATACCCGAGTTGGAGCAAGAAGAAA
ACAGACACAGATGAACCTAGGCTTCCACACTCGTTCAATTCGAATATAAGGATGTACAAATACTGTGAGGGACAA
TATTTTGGACCACATTACGATGATTCCGTCAAGGATACATTAACTGGTGTCAAGTCTGAATGGACGTTGTTGATT
TATTTGTCTGGTATAGAAGATGGTGTTGAAGGAGGAGAGACTGTTTTTTACAGGGAGGAAAGAGGGAAACCTAGG
GAAAGTATCGTACCACAACTAAACCGGGGGACAGCACTCTTGCATAGACATGGTCAAAATTGTATGTTGCACGAA
GGTTCCCCAGTCAAGAGTGGCACAAAATACGTTCTGCGGTCAGATTTGATGTTCATGGGATGA
Transcript >Agabi119p4|062210
ATGGCTAACGCGTCTCCCTTGCACCATGTCTACAGTCTGGTCAAGTCTCTGCTATTGGACCGACGCTACTTCTGG
ACGTTGGCGAGCTTCGTTCTCATAGGGGATGTGGTCCTCACGGAAATCATCATCAAGTTCATTTCTTACACAGAA
ATTGATTGGGAGACCTACATGATCCAAACGGAACTTTATATCAAAGGGCAATATAACTACTCTTTGATATCAGGA
CCCACGGGACCACTGGTGTACCCCGCTGGTCACGTCAGGATTCATGAATACTTGTATAGATTCACAAACGCAGGT
CGCGACATTCGATTTGCACAACACATCTATGGTATTTTGTATATCCTTACCCTAACGGTGATCAAACGTCTGCAT
TCCATATTTGTCCTTAGGCTGTTCAATGACTGCTGGGCTCTCTTTTTAATGGCTTTGTCGATATTGGCGTATCAG
TTCAATCTCGATGATACTGGTATACTATTCTATGGCCTTGCCCTTTCTGTTAAAATGTCGATTCTACTATACCTT
CCCGGTCTTCTGGTTATTATTTTCAAACGTCGCGGACTTGTGACAACACTTCGTCAGCTGCTCACCGTCATAGCA
ATCCAAGCGCTACTTGCCTCCCCATTTATTTCTGAAGACCCATGGAGCTACTTGAAAGGTGCCTTTGACCTAGGC
CGTGTATTTCTGTATAAATGGACTGTGAACTGGAGATTTGTCGACGAGGGAACGTTTTTGAACCCGACTTTCGCT
CTGAGTTTACTCGTGGGGCATATTTCCGCGTTGGTGGCTTTTGGGTTGTTCAAATGGTGTAAATTGGATGGAGGT
GTTTGGAAGGTTTTGGATCGGGGATTAAGACGACCGCGTCATCCTGCTGGACTTGCTCCGACCAATCCCGATTAC
ACCGCTACCGTCTTATTCACTTCCAATCTGATTGGCATTCTTTTTGCGCGGTCATTGCATTACCAGTTTTACTCC
TGGTATTCAATGCAAATACCTTTTTTGGCTTGGAGGACACGATATCCGATTATACTGAAGCTTGCTCTTCTTCTC
ATGATTGAATACGCGTGGAATGTCTATCCTTCCACCGATCTTTCGTCTGCGGCTCTCTTGGCTGGAAATTCATTG
TTACTTATTGGAGTATGGTTTGGATATCCAAATGGTGTAACTACGAGTCAAGCCGCGTCTACCCAGCGTAAGGCT
AACCATCACCAGCCATCAATCTTTGGTCATTTCCTTCTTGCCTTGCTTAACTCACTACTCGTTTGTACCAATACC
ATGCCTAAGAAAAAAGCGGCGACTTCTAAATCTAAATCTGATATTCCTTCGACTACAACAAAGGCATCTATTGCC
CCAGTAACAGCCTCCATGGTGTTTCCAGATCTGGCTCCGAAACAAGGACTTGAATGCCGGACCATCCTTGAAGAT
CAAATTCTAGTCATCGACGAATTCTTATCTCCAGCAGAATGCAAGATCTACGCCAAATTCATTGATAATCTCCCA
CTTGAGCTCACTCCACCGAAGAAAAGAGGGGAGGCGGAACGAGTTAATTACAGGTTTTCTGTTGCGTCTTTGGAT
TTCGCTCAGAGGTTGCATACCCTCCTGACGCCTCATTTACCGTCATTTCCATACCCGAGTTGGAGCAAGAAGAAA
ACAGACACAGATGAACCTAGGCTTCCACACTCGTTCAATTCGAATATAAGGATGTACAAATACTGTGAGGGACAA
TATTTTGGACCACATTACGATGATTCCGTCAAGGATACATTAACTGGTGTCAAGTCTGAATGGACGTTGTTGATT
TATTTGTCTGGTATAGAAGATGGTGTTGAAGGAGGAGAGACTGTTTTTTACAGGGAGGAAAGAGGGAAACCTAGG
GAAAGTATCGTACCACAACTAAACCGGGGGACAGCACTCTTGCATAGACATGGTCAAAATTGTATGTTGCACGAA
GGTTCCCCAGTCAAGAGTGGCACAAAATACGTTCTGCGGTCAGATTTGATGTTCATGGGATGA
Gene >Agabi119p4|062210
ATGGCTAACGCGTCTCCCTTGCACCATGTCTACAGTCTGGTCAAGTCTCTGCTATTGGACCGACGCTACTTCTGG
ACGTTGGCGAGCTTCGTTCTCATAGGGGATGTGGTCCTCACGGAAATCATCATCAAGTTCATTTCTTGTAGGTCC
AAAGTCGAGGGCCCACTACGATTAATTCATGCAACAACTTCTCCAGACACAGAAATTGATTGGGAGACCTACATG
ATCCAAACGGAACTTTATATCAAAGGGCAATATAACTACTCTTTGATATCAGGACCCACGGGACCACTGGTGTGC
GTACGAGACCCAGTTCAGAGTTAAACTAGAACTCATCGCGCTTCCAGGTACCCCGCTGGTCACGTCAGGATTCAT
GAATACTTGTATAGATTCACAAACGCAGGTCGCGACATTCGATTTGCACAACACATCTATGGTATTTTGTATATC
CTTACCCTAACGGTGATGTGCGCAATCTATCACAAAGCACAAAACATTCCAAACTGGGTTCTGCTGCTATTGCCC
CTCAGCAAACGTCTGCATTCCATATTTGTCCTTAGGCTGTTCAATGACTGCTGGGCTCTCTTTTTAATGGCTTTG
TCGATATTGGCGTATCAGTTCAATCTCGATGATACTGGTATACTATTCTATGGGTGAGGTTTCATTCTTTCCGGA
TTTTATGAGTACTGATACCATTTTCATAGCCTTGCCCTTTCTGTTAAAATGTCGATTCTACTATACCTTCCCGGT
CTTCTGGTTATTATTTTCAAACGTCGCGGACTTGTGACAACACTTCGTCAGCTGCTCACCGTCATAGCAATCCAA
GCGCTACTTGCCTCCCCATTTATTTCTGAAGACCCATGGAGCTACTTGAAAGGTGCCTTTGACCTAGGCCGTGTA
TTTCTGTATAAATGGACTGTGAACTGGAGATTTGTCGACGAGGGAACGTTTTTGAACCCGACTTTCGCTCTGAGT
TTACTCGTGGGGCATATTTCCGCGTTGGTGGCTTTTGGGTTGTTCAAATGGTGTAAATTGGATGGAGGTGTTTGG
AAGGTTTTGGATCGGGGATTAAGACGACCGCGTCATCCTGCTGGACTTGCTCCGACCAATCCCGATTGTAAGATT
TCTCTGACAAACATAACCCATTGGTTTCTTATGTTATGATTGTAGACACCGCTACCGTCTTATTCACTTCCAATC
TGATTGGCATTCTTTTTGCGCGGTCATTGCATTACCAGTTTTACTCCTGGTATTCAATGCAAATACCTTTTTTGG
CTTGGAGGACACGATATCCGATTATACTGAAGTGCGTACATGCCATTTGTAGAGCTTGTGCATTACCTTCTGACT
AATTTGTTGAAGGCTTGCTCTTCTTCTCATGATTGAATACGCGTGGAATGTCTATCCTTCCACCGATCTTTCGTC
TGCGGCTCTCTTGGCTGGAAATTCATTGTTACTTATTGGAGTATGGTTTGGATATCCAAATGGTGTAACTACGAG
TCAAGCCGCGTCTACCCAGCGTAAGGCTAAGTAATGTAGAGTAATAATACCATACCGTGGTGATTGAAGTGGCAA
AGCCATCACCAGCCATCAATCTTTGGTCATTTCCTTCTTGCCTTGCTTAACTCACTACTCGTTTGTACCAATACC
ATGCCTAAGAAAAAAGCGGCGACTTCTAAATCTAAATCTGATATTCCTTCGACTACAACAAAGGCATCTATTGCC
CCAGTAACAGCCTCCATGGTGTTTCCAGATCTGGCTCCGAAACAAGGACTTGAATGCCGGACCATCCTTGAAGAT
CAAATTCTAGTCATCGACGTATGCCAACTCTTTCGTGTCCCGAGAACGGTTCTCTCGAAAACTTCATACCAATAG
GAATTCTTATCTCCAGCAGAATGCAAGATCTACGCCAAATTCATTGATAATCTCCCACTTGAGCTCACTCCACCG
AAGAAAAGAGGGGAGGCGGAACGAGTTAATTGTATGTCTCTCTCTTTACCTTTCCGGTCGCATGAGTATATGACT
GCTATCTGACGCTTTTACGTGCGGCTGACTAGACAGGTTTTCTGTTGCGTCTTTGGATTTCGCTCAGAGGTTGCA
TACCCTCCTGACGCCTCATTTACCGTCATTTCCATACCCGAGTTGGAGCAAGAAGAAAACAGACACAGATGAACC
TAGGCTTCCACACTCGTTCAATTCGAATATAAGGATGTACAAATACTGTGAGGGACAATATTTTGGGTATGTGTA
TGCGGAACATCGTATGAAATTTCATTCGAAGTAACTCATTTACAAAGACCACATTACGATGATTCCGTCAAGGAT
ACATTAACTGGTGTCAAGTCTGAATGGACGTTGTTGATTTATTTGTCTGGTATAGAAGATGGTGTTGAAGGAGGA
GAGGTTAGTTATATATTTATATATTCAATCCATTATGACTTTAGCCCGAGATGACCGGTCCACAGACTGTTTTTT
ACAGGGAGGAAAGAGGGAAACCTAGGGAAAGTATCGTACCACAACTAAACCGGGGGACAGCACTCTTGCATAGGT
AAAGTATTGGTCTTCTATCACCGAAAGTCGTTTTCACGTCGCGCTTTTAGACATGGTCAAAATTGTATGTTGCAC
GAAGGTTCCCCAGTCAAGAGTGGCACAAAATACGTTCTGCGGTCAGATTTGATGTTCATGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail