Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061960
Gene name
Locationscaffold_03b:370371..371670
Strand-
Gene length (bp)1299
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 1.3E-37 215 318
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.2E-09 81 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 5 320 6.0E-75
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 4 320 2.0E-73
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 1 323 6.0E-49
sp|Q6CR99|P5CR_KLULA Pyrroline-5-carboxylate reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRO3 PE=1 SV=1 3 320 2.0E-48
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 72 298 7.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 5 320 6.0E-75
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 4 320 2.0E-73
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 1 323 6.0E-49
sp|Q6CR99|P5CR_KLULA Pyrroline-5-carboxylate reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRO3 PE=1 SV=1 3 320 2.0E-48
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 72 298 7.0E-46
sp|P54904|P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana GN=PROC1 PE=2 SV=1 105 320 6.0E-44
sp|O04016|P5CR_ACTCH Pyrroline-5-carboxylate reductase OS=Actinidia chinensis PE=2 SV=1 90 318 1.0E-43
sp|P17817|P5CR_SOYBN Pyrroline-5-carboxylate reductase OS=Glycine max PE=2 SV=1 90 318 1.0E-43
sp|Q5RAQ3|P5CR2_PONAB Pyrroline-5-carboxylate reductase 2 OS=Pongo abelii GN=PYCR2 PE=2 SV=1 103 318 2.0E-43
sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens GN=PYCR2 PE=1 SV=1 103 318 3.0E-42
sp|Q17QJ7|P5CR2_BOVIN Pyrroline-5-carboxylate reductase 2 OS=Bos taurus GN=PYCR2 PE=2 SV=1 103 318 4.0E-42
sp|Q5R9X6|P5CR1_PONAB Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Pongo abelii GN=PYCR1 PE=2 SV=1 103 318 9.0E-42
sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens GN=PYCR1 PE=1 SV=2 103 318 9.0E-42
sp|Q4R6W7|P5CR2_MACFA Pyrroline-5-carboxylate reductase 2 OS=Macaca fascicularis GN=PYCR2 PE=2 SV=1 103 318 1.0E-41
sp|Q6AY23|P5CR2_RAT Pyrroline-5-carboxylate reductase 2 OS=Rattus norvegicus GN=Pycr2 PE=2 SV=1 103 318 1.0E-41
sp|Q922Q4|P5CR2_MOUSE Pyrroline-5-carboxylate reductase 2 OS=Mus musculus GN=Pycr2 PE=1 SV=1 103 318 1.0E-41
sp|Q58DT4|P5CR1_BOVIN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Bos taurus GN=PYCR1 PE=2 SV=1 103 318 2.0E-41
sp|Q922W5|P5CR1_MOUSE Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Mus musculus GN=Pycr1 PE=1 SV=1 103 318 2.0E-41
sp|Q04708|P5CR_PEA Pyrroline-5-carboxylate reductase OS=Pisum sativum GN=PROC PE=2 SV=1 90 318 2.0E-40
sp|Q53H96|P5CR3_HUMAN Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens GN=PYCRL PE=1 SV=3 107 320 2.0E-39
sp|Q9HH99|P5CR_METAC Pyrroline-5-carboxylate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proC PE=3 SV=1 103 320 2.0E-39
sp|P74572|P5CR_SYNY3 Pyrroline-5-carboxylate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=proC PE=3 SV=1 107 320 1.0E-38
sp|Q4R531|P5CR3_MACFA Pyrroline-5-carboxylate reductase 3 OS=Macaca fascicularis GN=PYCRL PE=2 SV=1 142 320 9.0E-38
sp|Q58D08|P5CR3_BOVIN Pyrroline-5-carboxylate reductase 3 OS=Bos taurus GN=PYCRL PE=2 SV=1 90 320 6.0E-35
sp|A1L2Q8|P5CR3_XENLA Pyrroline-5-carboxylate reductase 3 OS=Xenopus laevis GN=pycrl PE=2 SV=2 107 320 2.0E-34
sp|Q9DCC4|P5CR3_MOUSE Pyrroline-5-carboxylate reductase 3 OS=Mus musculus GN=Pycrl PE=1 SV=2 107 320 9.0E-34
sp|P0A9L9|P5CR_SHIFL Pyrroline-5-carboxylate reductase OS=Shigella flexneri GN=proC PE=3 SV=1 104 320 3.0E-33
sp|P0A9L8|P5CR_ECOLI Pyrroline-5-carboxylate reductase OS=Escherichia coli (strain K12) GN=proC PE=1 SV=1 104 320 3.0E-33
sp|Q5PQJ6|P5CR3_RAT Pyrroline-5-carboxylate reductase 3 OS=Rattus norvegicus GN=Pycrl PE=2 SV=1 107 320 6.0E-33
sp|Q5SPD7|P5CR3_DANRE Pyrroline-5-carboxylate reductase 3 OS=Danio rerio GN=pycrl PE=2 SV=1 107 324 3.0E-32
sp|P0C1E5|P5CR_CORML Pyrroline-5-carboxylate reductase OS=Corynebacterium melassecola GN=proC PE=3 SV=1 105 320 6.0E-31
sp|P0C1E4|P5CR_CORGL Pyrroline-5-carboxylate reductase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=proC PE=3 SV=1 105 320 7.0E-31
sp|P46725|P5CR_MYCLE Pyrroline-5-carboxylate reductase OS=Mycobacterium leprae (strain TN) GN=proC PE=3 SV=1 97 318 1.0E-30
sp|P54552|P5CR2_BACSU Pyrroline-5-carboxylate reductase 2 OS=Bacillus subtilis (strain 168) GN=proI PE=3 SV=1 113 322 1.0E-29
sp|O66553|P5CR_AQUAE Pyrroline-5-carboxylate reductase OS=Aquifex aeolicus (strain VF5) GN=proC PE=3 SV=1 73 318 4.0E-27
sp|P22008|P5CR_PSEAE Pyrroline-5-carboxylate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proC PE=1 SV=2 107 320 2.0E-26
sp|P43869|P5CR_HAEIN Pyrroline-5-carboxylate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proC PE=3 SV=1 98 318 2.0E-26
sp|P27771|P5CR_TREPA Pyrroline-5-carboxylate reductase OS=Treponema pallidum (strain Nichols) GN=proC PE=1 SV=2 111 311 3.0E-26
sp|P9WHU7|P5CR_MYCTU Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=proC PE=1 SV=1 97 318 1.0E-25
sp|P9WHU6|P5CR_MYCTO Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=proC PE=3 SV=1 97 318 1.0E-25
sp|P54893|P5CR_THET2 Pyrroline-5-carboxylate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=proC PE=3 SV=1 145 320 2.0E-25
sp|Q20848|P5CR_CAEEL Putative pyrroline-5-carboxylate reductase OS=Caenorhabditis elegans GN=F55G1.9 PE=3 SV=1 116 320 2.0E-25
sp|Q54IL7|P5CR1_DICDI Pyrroline-5-carboxylate reductase 1 OS=Dictyostelium discoideum GN=pycr1 PE=3 SV=1 103 318 4.0E-24
sp|Q55E34|P5CR2_DICDI Pyrroline-5-carboxylate reductase 2 OS=Dictyostelium discoideum GN=pycr2 PE=3 SV=1 103 317 2.0E-23
sp|P52053|P5CR_VIBAL Pyrroline-5-carboxylate reductase OS=Vibrio alginolyticus GN=proC PE=3 SV=1 105 318 9.0E-23
sp|P0CI77|P5CR1_BACSU Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis (strain 168) GN=proH PE=3 SV=1 76 320 1.0E-20
sp|E0TY11|P5CR1_BACPZ Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=proH PE=3 SV=2 76 318 8.0E-20
sp|Q9CPE8|P5CR_PASMU Pyrroline-5-carboxylate reductase OS=Pasteurella multocida (strain Pm70) GN=proC PE=3 SV=1 98 318 5.0E-19
sp|Q9ZK56|P5CR_HELPJ Pyrroline-5-carboxylate reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=proC PE=3 SV=1 102 314 4.0E-18
sp|Q4L6K3|P5CR_STAHJ Pyrroline-5-carboxylate reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=proC PE=3 SV=1 111 320 4.0E-17
sp|O25773|P5CR_HELPY Pyrroline-5-carboxylate reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=proC PE=3 SV=1 102 301 5.0E-17
sp|Q8CP51|P5CR_STAES Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proC PE=3 SV=1 111 320 6.0E-17
sp|Q5HP48|P5CR_STAEQ Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proC PE=3 SV=1 111 320 6.0E-17
sp|Q49XV0|P5CR_STAS1 Pyrroline-5-carboxylate reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=proC PE=3 SV=1 92 318 2.0E-15
sp|Q7A0U1|P5CR_STAAW Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MW2) GN=proC PE=3 SV=1 111 318 3.0E-14
sp|Q6G961|P5CR_STAAS Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MSSA476) GN=proC PE=3 SV=1 111 318 3.0E-14
sp|Q7A5G8|P5CR_STAAN Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain N315) GN=proC PE=1 SV=1 111 318 3.0E-14
sp|Q99TZ0|P5CR_STAAM Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=proC PE=3 SV=1 111 318 3.0E-14
sp|Q6GGJ5|P5CR_STAAR Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MRSA252) GN=proC PE=3 SV=1 111 318 3.0E-14
sp|Q5HFR9|P5CR_STAAC Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain COL) GN=proC PE=3 SV=1 111 318 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061960
MGYTLCVLGCGTMGIAILSGVLDSLDTSKHSLTNGTNGTKGTNGTNGVHKWEAHTPGTVSPVGPPDVSTPTRFIA
CVSREATAKKLVSLFASMGEAASNVEVLASKNVQAVKQADVVLLCCKPPVAEKILSEQGMGDVLQGKLLISILAG
VTISQLTDWVPPSTRVVRAMPNTPCKIREGMTVVTTLPPSPDEESDDVIILKIFSSIGRCRYLDEKHFDAATALA
GSGPAIACVLLDAMADGGVMMGLSRSAALELAAQTFQGAARMVLQNAHPAQIKDAVCTPGGCTIAGLLALEDGRV
RSTIARGIQAATERAGELGQFSKK*
Coding >Agabi119p4|061960
ATGGGCTACACTCTTTGTGTTTTAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTT
GATACTTCTAAACATTCTCTCACCAACGGCACCAACGGCACAAAAGGTACCAATGGTACCAATGGTGTTCACAAG
TGGGAGGCGCATACCCCTGGCACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCT
TGCGTGAGCCGTGAAGCGACGGCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTC
GAGGTTCTCGCATCAAAAAATGTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGCTGCAAGCCTCCAGTC
GCTGAGAAAATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGGCAAACTCCTTATCAGTATCCTCGCTGGT
GTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGTGGTCCGTGCTATGCCGAATACCCCTTGC
AAAATTCGGGAAGGAATGACTGTCGTCACCACTTTACCACCCTCGCCAGATGAGGAAAGCGACGACGTCATCATT
CTAAAAATATTTTCTTCCATTGGAAGATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCC
GGGTCTGGACCTGCTATCGCATGTGTTTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGA
AGCGCAGCCTTGGAGCTCGCCGCTCAAACCTTTCAGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCA
CAGATCAAAGATGCAGTTTGCACCCCTGGAGGATGTACAATTGCTGGGCTCTTGGCTCTTGAAGACGGTCGAGTG
CGCTCCACCATTGCTCGTGGCATTCAAGCAGCCACAGAGAGGGCCGGCGAGCTCGGCCAATTCTCGAAAAAATGA
Transcript >Agabi119p4|061960
ATGGGCTACACTCTTTGTGTTTTAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTT
GATACTTCTAAACATTCTCTCACCAACGGCACCAACGGCACAAAAGGTACCAATGGTACCAATGGTGTTCACAAG
TGGGAGGCGCATACCCCTGGCACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCT
TGCGTGAGCCGTGAAGCGACGGCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTC
GAGGTTCTCGCATCAAAAAATGTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGCTGCAAGCCTCCAGTC
GCTGAGAAAATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGGCAAACTCCTTATCAGTATCCTCGCTGGT
GTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGTGGTCCGTGCTATGCCGAATACCCCTTGC
AAAATTCGGGAAGGAATGACTGTCGTCACCACTTTACCACCCTCGCCAGATGAGGAAAGCGACGACGTCATCATT
CTAAAAATATTTTCTTCCATTGGAAGATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCC
GGGTCTGGACCTGCTATCGCATGTGTTTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGA
AGCGCAGCCTTGGAGCTCGCCGCTCAAACCTTTCAGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCA
CAGATCAAAGATGCAGTTTGCACCCCTGGAGGATGTACAATTGCTGGGCTCTTGGCTCTTGAAGACGGTCGAGTG
CGCTCCACCATTGCTCGTGGCATTCAAGCAGCCACAGAGAGGGCCGGCGAGCTCGGCCAATTCTCGAAAAAATGA
Gene >Agabi119p4|061960
ATGGGCTACACTCTTTGTGTTTTAGGTTTATCTCTTAATACACATAACGCCGCCATTGTCTAATCAGTACCCTTG
ATAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTTGATACTTCTAAACATTCTCTC
ACCAACGGCACCAACGGCACAAAAGGTACCAATGGTACCAATGGTGTTCACAAGTGGGAGGCGCATACCCCTGGC
ACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCTTGCGTGAGCCGTGAAGCGACG
GCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTCGAGGTTCTCGCATCAAAAAAT
GTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGGTATGTATAAACACTTTATCCGGACGCATTTATCAAT
GAATTTCTACAGCTGCAAGCCTCCAGTCGCTGAGAAAATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGG
CAAACTCCTTATCAGTATCCTCGCTGGTGTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGT
GGTCCGTGCTATGCCGAATACCCCTTGCAAAGTCCGTGTGCACATTTCTCCTTTTTCTTCACACTGTCTCTAACA
AGCAGAAAAAAAATTTCTTTTCGATTCTTTTCTTTTTTTGGACCACGATCAGATTCGGGAAGGAATGACTGTCGT
CACCACTTTACCACCCTCGCCAGATGAGGAAAGCGACGACGTCATCATTCTAAAAATATTTTCTTCCATTGGAAG
ATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCCGGGTCTGGACCTGCTATCGCATGTGT
TTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGAAGCGCAGCCTTGGAGCTCGCCGCTCA
AAGTCAGTCTTTCCCATTTTAGTTTTACCGAATCCATGGTACTGATCCCCGATGTTTTCTTTCATGTAGCCTTTC
AGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCACAGATCAAAGATGCAGTTTGCAGTACGTTGATCT
TTTCTCCACTTTCGATTGTGCCTGAAACGTCATGTGAAAATCATAGCCCCTGGAGGATGTACAATTGCTGGGCTC
TTGGCTCTTGAAGACGGTCGAGTGCGCTCCACCATTGCTCGTGGCATTCAAGCAGCCACAGAGAGGGCCGGCGAG
CTCGGCCAATTCTCGAAAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail