Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061880
Gene name
Locationscaffold_03b:359787..361541
Strand-
Gene length (bp)1754
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 4.5E-33 110 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 22 261 5.0E-48
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 39 289 9.0E-46
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 39 289 1.0E-45
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 31 288 4.0E-45
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 65 269 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 22 261 5.0E-48
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 39 289 9.0E-46
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 39 289 1.0E-45
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 31 288 4.0E-45
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 65 269 5.0E-45
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 54 287 8.0E-45
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 38 273 1.0E-44
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 30 259 2.0E-41
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 33 258 6.0E-41
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 89 259 1.0E-38
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 25 258 1.0E-35
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 21 266 4.0E-32
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 266 2.0E-29
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 100 276 2.0E-26
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 105 260 1.0E-20
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 6 276 2.0E-17
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 28 249 6.0E-15
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 25 249 2.0E-14
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 25 249 2.0E-13
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 112 289 2.0E-13
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 14 287 2.0E-12
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 14 249 1.0E-11
sp|A4II83|LPPR1_XENTR Lipid phosphate phosphatase-related protein type 1 OS=Xenopus tropicalis GN=lppr1 PE=2 SV=1 127 251 8.0E-11
sp|O43688|PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens GN=PLPP2 PE=1 SV=1 53 249 1.0E-10
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 14 249 3.0E-10
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 53 254 4.0E-10
sp|Q8BFZ2|LPPR1_MOUSE Lipid phosphate phosphatase-related protein type 1 OS=Mus musculus GN=Lppr1 PE=1 SV=1 127 251 4.0E-10
sp|Q6WAY2|LPPR1_RAT Lipid phosphate phosphatase-related protein type 1 OS=Rattus norvegicus GN=Lppr1 PE=2 SV=1 127 251 6.0E-10
sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens GN=PLPP3 PE=1 SV=1 14 249 2.0E-09
sp|Q2HJ61|PLPP2_BOVIN Phospholipid phosphatase 2 OS=Bos taurus GN=PLPP2 PE=2 SV=1 53 254 3.0E-09
sp|Q8TBJ4|LPPR1_HUMAN Lipid phosphate phosphatase-related protein type 1 OS=Homo sapiens GN=LPPR1 PE=2 SV=1 127 251 3.0E-09
sp|Q8K593|PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus GN=Plpp2 PE=2 SV=1 53 249 5.0E-09
sp|Q8BJ52|LPPR5_MOUSE Lipid phosphate phosphatase-related protein type 5 OS=Mus musculus GN=Lppr5 PE=2 SV=1 127 285 2.0E-08
sp|Q6IQH6|LPPR1_DANRE Lipid phosphate phosphatase-related protein type 1 OS=Danio rerio GN=lppr1 PE=2 SV=1 127 251 2.0E-08
sp|Q32ZL2|LPPR5_HUMAN Lipid phosphate phosphatase-related protein type 5 OS=Homo sapiens GN=LPPR5 PE=2 SV=2 127 251 3.0E-08
sp|Q10022|YSX3_CAEEL Uncharacterized protein T28D9.3 OS=Caenorhabditis elegans GN=T28D9.3 PE=1 SV=1 54 252 4.0E-08
sp|Q6GM05|LPPR5_XENLA Lipid phosphate phosphatase-related protein type 5 OS=Xenopus laevis GN=lppr5 PE=2 SV=2 127 251 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 26 45 19
2 77 99 22
3 106 125 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061880
MRFSLRPSRSSNRNGRPMSPLRRRKLLLSYVPDWLLTIILAGIFFSLDKVEGYRRVFALEDTSLRHPYAVHERVP
NIALYFICFVAPFLLQPVVNVLTIRSWWDLHNSSLGLILSLALTGSVTQFSKITVGRPRPDIVDRCQPPVGATDP
EFGLSSWQICTQPDNGILRDGFRSFPSGHSSMSFAGLGFLSFYLAGKLHLFDKRGHTGKAWLSLAPFCCAALVAI
SRTMDYRHHWHDVLVGSLLGTVMAYFSYRQYYPPLESELSHRPFSPRIKRDDDELIPTHNHHPSGSNFPFVQPPT
TSTQGNGQYTVTNNDEYELDGTVLRPHTEPLEEMWKRDGPGVSDTDQSPSYEGGEQVYQANTAPSLPPIRTSSPP
QAYVYEPRAQPV*
Coding >Agabi119p4|061880
ATGCGTTTCTCCCTCAGACCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCCCTTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGCTTCTCACCATAATCCTCGCTGGCATCTTTTTTTCTCTTGACAAAGTT
GAAGGGTACCGTAGGGTTTTCGCATTGGAAGATACGTCACTCCGCCATCCTTATGCCGTGCACGAGCGCGTTCCA
AATATCGCTCTCTACTTTATCTGCTTCGTCGCGCCTTTCTTGCTTCAACCAGTAGTTAACGTGCTCACTATACGC
TCATGGTGGGACCTCCACAATTCATCCCTTGGATTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGACGCAATTC
TCAAAAATAACAGTAGGAAGGCCTCGACCAGATATAGTTGATCGTTGCCAACCTCCTGTTGGCGCCACTGATCCA
GAGTTTGGTTTGTCGAGCTGGCAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTC
CCCTCTGGTCATTCTAGCATGTCTTTTGCTGGACTTGGTTTCTTGTCGTTTTATCTCGCTGGTAAACTGCACTTG
TTCGATAAACGGGGCCATACTGGTAAAGCTTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCTCTTGTTGCAATT
TCTCGCACAATGGATTACCGCCACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATAC
TTTTCCTACCGCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGA
GACGATGACGAACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAACCTCCGACG
ACCTCGACTCAGGGAAATGGCCAGTATACGGTTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGT
CCACATACTGAACCGCTTGAAGAGATGTGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGT
TATGAAGGAGGGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCT
CAGGCGTACGTATATGAGCCGAGGGCACAGCCTGTTTAA
Transcript >Agabi119p4|061880
ATGCGTTTCTCCCTCAGACCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCCCTTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGCTTCTCACCATAATCCTCGCTGGCATCTTTTTTTCTCTTGACAAAGTT
GAAGGGTACCGTAGGGTTTTCGCATTGGAAGATACGTCACTCCGCCATCCTTATGCCGTGCACGAGCGCGTTCCA
AATATCGCTCTCTACTTTATCTGCTTCGTCGCGCCTTTCTTGCTTCAACCAGTAGTTAACGTGCTCACTATACGC
TCATGGTGGGACCTCCACAATTCATCCCTTGGATTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGACGCAATTC
TCAAAAATAACAGTAGGAAGGCCTCGACCAGATATAGTTGATCGTTGCCAACCTCCTGTTGGCGCCACTGATCCA
GAGTTTGGTTTGTCGAGCTGGCAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTC
CCCTCTGGTCATTCTAGCATGTCTTTTGCTGGACTTGGTTTCTTGTCGTTTTATCTCGCTGGTAAACTGCACTTG
TTCGATAAACGGGGCCATACTGGTAAAGCTTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCTCTTGTTGCAATT
TCTCGCACAATGGATTACCGCCACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATAC
TTTTCCTACCGCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGA
GACGATGACGAACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAACCTCCGACG
ACCTCGACTCAGGGAAATGGCCAGTATACGGTTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGT
CCACATACTGAACCGCTTGAAGAGATGTGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGT
TATGAAGGAGGGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCT
CAGGCGTACGTATATGAGCCGAGGGCACAGCCTGTTTAA
Gene >Agabi119p4|061880
ATGCGTTTCTCCCTCAGACCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCCCTTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGTGAGCACTCCGAGGGCTCCTGTTCGTATCACCGCTGACCAGTTTCAAG
GCTTCTCACCATAATCCTCGCGTATGTCAATACTTTGATCTCTATCTCCGCCACTCAACCTGTCTTCAAGTGGCA
TCTTTTTTTCTCTTGACAAAGTTGAAGGGTACCGTAGGGTTTTCGCATTGGAAGATACGTCGTAAGTTGCTGCAC
TGCCTCGAATTCACCATGAGGTCTCTAATTTCTGCTTCCCTCTCGACAGACTCCGCCATCCGTGAGTTTTACTGT
TTGGTCCTTTTGACTTTTGACTTACTGACAATCGTTGTCACTAGTTATGCCGTGCACGAGCGCGTTCCAGTATGA
CCTTTAACGTCTGATGACCGTCTTCATTTAATTTTTCATCTCTAGAATATCGCTCTCTACTTTATCTGCTTCGTC
GCGCCTTTCTTGCTTCAACCAGTAGTTAACGTGCTCACTATACGCTCATGGTGGGACCTCCACAATTGTACGTCA
ATCAAATACTCTAACCTCGCACCCGTTAACGCATTTTTTCCGTTCCGACAGCATCCCTTGGATGTGCGTGTTGTT
GACGTCATTCAATAATGCTACCGCTAATGAGACGCTTCGCAGTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGA
CGCAATTCTCAAAAATAACAGTAGGAAGGCCTCGACCAGGTACATTAACCCGGATAATTATTCAGAATTTGGTGC
TAACCTGCTTATAGATATAGTTGATCGTTGCCAACCTCCTGTTGGCGCCACTGATCCAGAGTTTGGTTTGTCGAG
CTGGCAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTCCCCTCTGGTCATTCTAG
CAGTGCGTCAATTCCTCTTTTATTGGCGAAATTACAGGTTTAAACATGTGTTCAGTGTCTTTTGCTGGACTTGGT
TTCTTGTCGTTTTATCTCGCTGGTAAACTGCACTTGTTCGATAAACGGGGCCATACTGTAAGTGAAACCGTCAAC
TCATATTTTCAGCATATAGTTATCTTTTTTAGGGTAAAGCTTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCTC
TTGTTGCAATTTCTCGCACAATGGATTACCGCCGTAAGTGCTTGGATAATCTTCCTCTTTCTTTGTGATATTGAC
CGCTTGATACAGACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATACTTTTCCTACC
GCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGAGACGATGACG
AACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAACCTCCGACGACCTCGACTC
AGGGAAATGGCCAGTATACGGTTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGTCCACATACTG
AACCGCTTGAAGAGATGTGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGTTATGAAGGAG
GGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCTCAGGCGTACG
TATATGAGCCGAGGGCACAGCCTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail