Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061850
Gene name
Locationscaffold_03b:351372..354173
Strand-
Gene length (bp)2801
Transcript length (bp)2214
Coding sequence length (bp)2214
Protein length (aa) 738

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00534 Glycos_transf_1 Glycosyl transferases group 1 1.8E-18 497 674
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 4.5E-11 531 661

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6YRN9|TREPH_PLEPU Trehalose phosphorylase OS=Pleurotus pulmonarius GN=TP PE=2 SV=1 1 737 0.0E+00
sp|Q9UV63|TREPH_PLESA Trehalose phosphorylase OS=Pleurotus sajor-caju GN=TP PE=1 SV=1 1 737 0.0E+00
sp|O75003|TREPH_GRIFR Trehalose phosphorylase OS=Grifola frondosa PE=1 SV=1 6 737 0.0E+00
sp|Q7LYW5|TRET_THELN Trehalose synthase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=treT PE=1 SV=1 248 678 2.0E-43
sp|Q9HH00|TRET_PYRFU Trehalose synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=treT PE=3 SV=1 248 678 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6YRN9|TREPH_PLEPU Trehalose phosphorylase OS=Pleurotus pulmonarius GN=TP PE=2 SV=1 1 737 0.0E+00
sp|Q9UV63|TREPH_PLESA Trehalose phosphorylase OS=Pleurotus sajor-caju GN=TP PE=1 SV=1 1 737 0.0E+00
sp|O75003|TREPH_GRIFR Trehalose phosphorylase OS=Grifola frondosa PE=1 SV=1 6 737 0.0E+00
sp|Q7LYW5|TRET_THELN Trehalose synthase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=treT PE=1 SV=1 248 678 2.0E-43
sp|Q9HH00|TRET_PYRFU Trehalose synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=treT PE=3 SV=1 248 678 2.0E-43
sp|O58762|TRET_PYRHO Trehalose synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=treT PE=1 SV=2 248 676 4.0E-38
sp|Q1ARU5|TRET_RUBXD Trehalose synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=treT PE=1 SV=1 248 676 3.0E-27
sp|Q81ST7|BSHA_BACAN N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus anthracis GN=bshA PE=1 SV=1 500 679 1.0E-11
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 583 677 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061850
MAHTAHPFYSVPSAAVRRRLSSSVSAKKPLVTATFSSLTPMWAGVAGVIINNNTEFEVAVSVHDSVYSTDFASVV
LPYDPNDPEKNAKTIEQYILQVLRRFSVEHLCKFLGAGVTLTLLKEVPNVCTRLWLDLDIVPFVFNIKQYHTDSL
TRPNIKHRISSTTGSYVPSGAETPTVYVDSAHLKAMSGLQTGVSGRLPIQRTLDEQADSAARKCLMNFGPGNNPR
LNIGPRNQVLVDDGGRVHLLDDLDEYRNTVGPRTWNAVIKLADELREKKVKIGFFSSTPQGGGVALMRHALIRFL
TALDVDAAWYVPNPSPAVFRTTKNNHNILQGVAAPDLRLTEEARDAFDAWILKNGLRWTAEGGPLARGGVDVAFI
DDPQMPGLIPLIKKIRPELPIVYRSHIEIRSDLVHVPGSPQEEVWKYLWKNIQLADLFISHPVSKFVPQDVPLEK
VALLGAATDWLDGLNKDLDPWDSQYYMGEFRALCARERMLELRWPQRDYIIQVARFDPSKGIPNVIDSYVKFREL
LKLKSPELEDEDHPQLLVCGHGAVDDPDASIIYDQIMQIVNSEPYEAYAKDIVVMRLPPSDQLLNSLMSNAKIAL
QLSTREGFEVKVSEALHTGKPVIASRTGGIPLQIEHGKSGYLCTPGDNEAVAGHLYDLYTDEILYKTMSDYAKTH
VSDEVGTVGNTAAWLYLAVMYNRGIKIKPNGAWLNDLLRTETGEDYEEGEPRLPRGGLKMQG*
Coding >Agabi119p4|061850
ATGGCTCATACCGCTCATCCCTTCTATTCTGTGCCCTCTGCCGCTGTACGACGCAGGCTTTCTTCCAGCGTCTCT
GCGAAGAAGCCACTGGTCACCGCGACTTTCTCTAGCCTCACGCCTATGTGGGCTGGCGTTGCTGGTGTTATTATC
AATAATAATACCGAGTTTGAGGTCGCTGTCTCGGTGCATGATTCGGTCTATAGCACCGACTTCGCATCCGTCGTT
CTTCCCTATGACCCCAACGATCCTGAAAAGAATGCCAAAACTATCGAACAATACATCCTTCAAGTCCTGCGCAGG
TTTTCTGTCGAGCATCTATGCAAGTTTCTGGGTGCTGGTGTCACGCTTACTCTCCTCAAAGAGGTTCCTAACGTC
TGCACGAGACTTTGGCTAGATCTAGACATCGTTCCTTTCGTGTTCAATATCAAACAGTATCACACTGATTCTCTG
ACGCGGCCCAACATCAAACACCGCATCTCATCTACTACTGGCTCCTACGTTCCATCTGGAGCCGAGACGCCTACG
GTGTACGTTGACTCTGCCCATCTGAAAGCGATGTCGGGTCTTCAGACAGGTGTCTCTGGGCGTCTCCCCATCCAA
CGCACACTTGACGAACAGGCTGACTCCGCCGCTCGCAAATGTCTTATGAATTTTGGACCTGGAAATAATCCTCGC
TTGAACATTGGACCTCGCAATCAAGTTCTAGTCGATGATGGTGGTCGAGTCCACCTTCTTGACGATCTTGACGAA
TATAGAAACACCGTTGGACCAAGGACCTGGAACGCTGTCATTAAGCTCGCTGATGAACTCCGAGAGAAAAAAGTG
AAGATCGGTTTCTTTTCTTCTACACCCCAAGGAGGTGGTGTTGCCCTCATGAGGCATGCCTTGATCCGTTTTCTC
ACAGCTTTGGACGTGGATGCGGCTTGGTATGTACCGAATCCATCCCCTGCAGTGTTTCGAACAACCAAAAACAAC
CACAACATCCTGCAAGGCGTTGCGGCTCCGGACCTACGTCTGACGGAAGAAGCCAGAGATGCATTCGATGCTTGG
ATCTTGAAGAATGGATTGCGCTGGACAGCAGAAGGCGGCCCCTTGGCTCGTGGTGGCGTTGATGTGGCGTTCATC
GATGACCCTCAGATGCCGGGTCTGATCCCTTTGATCAAGAAAATTAGGCCAGAACTTCCAATCGTTTATCGGTCT
CATATTGAAATCCGAAGTGATCTCGTTCACGTTCCCGGGTCACCGCAAGAAGAGGTCTGGAAGTATCTGTGGAAA
AATATACAGCTGGCCGATCTCTTCATAAGTCACCCGGTCAGCAAATTTGTCCCACAAGACGTTCCACTTGAGAAG
GTCGCTCTTCTCGGAGCGGCGACTGACTGGTTGGATGGCCTGAATAAGGATCTGGATCCCTGGGATTCTCAGTAT
TATATGGGAGAATTCCGCGCCCTCTGTGCCAGAGAAAGAATGCTTGAGCTCAGGTGGCCTCAACGCGATTATATC
ATCCAAGTCGCCCGGTTTGATCCCTCGAAGGGCATACCTAATGTCATTGACTCTTACGTCAAATTCCGCGAGCTT
CTCAAGCTGAAGTCTCCAGAACTTGAGGACGAAGATCATCCTCAGCTGTTGGTCTGTGGTCATGGAGCTGTTGAT
GATCCAGACGCCAGTATCATCTATGATCAAATCATGCAAATTGTCAATTCTGAACCGTACGAGGCGTATGCGAAA
GATATTGTCGTCATGCGCTTGCCACCCAGCGATCAATTGCTCAATTCCCTGATGTCCAATGCTAAGATCGCTTTG
CAACTGTCGACTCGTGAAGGTTTCGAAGTGAAGGTTTCCGAGGCTCTTCATACAGGGAAACCTGTCATTGCTTCG
AGAACTGGTGGGATTCCGCTTCAGATTGAGCACGGTAAATCCGGCTATCTTTGCACCCCGGGCGACAATGAAGCT
GTTGCTGGACATCTCTATGACCTCTATACGGATGAAATCCTTTACAAGACGATGAGCGACTACGCCAAGACCCAC
GTTTCCGATGAAGTTGGGACTGTTGGGAATACTGCTGCTTGGTTGTACTTGGCTGTTATGTACAATCGCGGCATC
AAGATCAAGCCCAACGGTGCTTGGCTCAATGACCTCCTTCGAACAGAGACAGGAGAGGATTATGAAGAAGGAGAA
CCGAGACTGCCGCGTGGGGGATTAAAAATGCAAGGTTGA
Transcript >Agabi119p4|061850
ATGGCTCATACCGCTCATCCCTTCTATTCTGTGCCCTCTGCCGCTGTACGACGCAGGCTTTCTTCCAGCGTCTCT
GCGAAGAAGCCACTGGTCACCGCGACTTTCTCTAGCCTCACGCCTATGTGGGCTGGCGTTGCTGGTGTTATTATC
AATAATAATACCGAGTTTGAGGTCGCTGTCTCGGTGCATGATTCGGTCTATAGCACCGACTTCGCATCCGTCGTT
CTTCCCTATGACCCCAACGATCCTGAAAAGAATGCCAAAACTATCGAACAATACATCCTTCAAGTCCTGCGCAGG
TTTTCTGTCGAGCATCTATGCAAGTTTCTGGGTGCTGGTGTCACGCTTACTCTCCTCAAAGAGGTTCCTAACGTC
TGCACGAGACTTTGGCTAGATCTAGACATCGTTCCTTTCGTGTTCAATATCAAACAGTATCACACTGATTCTCTG
ACGCGGCCCAACATCAAACACCGCATCTCATCTACTACTGGCTCCTACGTTCCATCTGGAGCCGAGACGCCTACG
GTGTACGTTGACTCTGCCCATCTGAAAGCGATGTCGGGTCTTCAGACAGGTGTCTCTGGGCGTCTCCCCATCCAA
CGCACACTTGACGAACAGGCTGACTCCGCCGCTCGCAAATGTCTTATGAATTTTGGACCTGGAAATAATCCTCGC
TTGAACATTGGACCTCGCAATCAAGTTCTAGTCGATGATGGTGGTCGAGTCCACCTTCTTGACGATCTTGACGAA
TATAGAAACACCGTTGGACCAAGGACCTGGAACGCTGTCATTAAGCTCGCTGATGAACTCCGAGAGAAAAAAGTG
AAGATCGGTTTCTTTTCTTCTACACCCCAAGGAGGTGGTGTTGCCCTCATGAGGCATGCCTTGATCCGTTTTCTC
ACAGCTTTGGACGTGGATGCGGCTTGGTATGTACCGAATCCATCCCCTGCAGTGTTTCGAACAACCAAAAACAAC
CACAACATCCTGCAAGGCGTTGCGGCTCCGGACCTACGTCTGACGGAAGAAGCCAGAGATGCATTCGATGCTTGG
ATCTTGAAGAATGGATTGCGCTGGACAGCAGAAGGCGGCCCCTTGGCTCGTGGTGGCGTTGATGTGGCGTTCATC
GATGACCCTCAGATGCCGGGTCTGATCCCTTTGATCAAGAAAATTAGGCCAGAACTTCCAATCGTTTATCGGTCT
CATATTGAAATCCGAAGTGATCTCGTTCACGTTCCCGGGTCACCGCAAGAAGAGGTCTGGAAGTATCTGTGGAAA
AATATACAGCTGGCCGATCTCTTCATAAGTCACCCGGTCAGCAAATTTGTCCCACAAGACGTTCCACTTGAGAAG
GTCGCTCTTCTCGGAGCGGCGACTGACTGGTTGGATGGCCTGAATAAGGATCTGGATCCCTGGGATTCTCAGTAT
TATATGGGAGAATTCCGCGCCCTCTGTGCCAGAGAAAGAATGCTTGAGCTCAGGTGGCCTCAACGCGATTATATC
ATCCAAGTCGCCCGGTTTGATCCCTCGAAGGGCATACCTAATGTCATTGACTCTTACGTCAAATTCCGCGAGCTT
CTCAAGCTGAAGTCTCCAGAACTTGAGGACGAAGATCATCCTCAGCTGTTGGTCTGTGGTCATGGAGCTGTTGAT
GATCCAGACGCCAGTATCATCTATGATCAAATCATGCAAATTGTCAATTCTGAACCGTACGAGGCGTATGCGAAA
GATATTGTCGTCATGCGCTTGCCACCCAGCGATCAATTGCTCAATTCCCTGATGTCCAATGCTAAGATCGCTTTG
CAACTGTCGACTCGTGAAGGTTTCGAAGTGAAGGTTTCCGAGGCTCTTCATACAGGGAAACCTGTCATTGCTTCG
AGAACTGGTGGGATTCCGCTTCAGATTGAGCACGGTAAATCCGGCTATCTTTGCACCCCGGGCGACAATGAAGCT
GTTGCTGGACATCTCTATGACCTCTATACGGATGAAATCCTTTACAAGACGATGAGCGACTACGCCAAGACCCAC
GTTTCCGATGAAGTTGGGACTGTTGGGAATACTGCTGCTTGGTTGTACTTGGCTGTTATGTACAATCGCGGCATC
AAGATCAAGCCCAACGGTGCTTGGCTCAATGACCTCCTTCGAACAGAGACAGGAGAGGATTATGAAGAAGGAGAA
CCGAGACTGCCGCGTGGGGGATTAAAAATGCAAGGTTGA
Gene >Agabi119p4|061850
ATGGCTCATACCGCTCATCCCTTCTATTCTGTGCCCTCTGCCGCTGTACGACGCAGGCTTTCTTCCAGCGTCTCT
GCGAAGAAGCCACTGGTCACCGCGACTTTCTCTAGCCTCACGGTGCGTATGTCTATAAAATTGCGTCTATAATAT
CCATCTAAACGGCTGCTCCATCGTTCAGCCTATGTGGGCTGGCGTTGCTGGTGTTATTATCAATAATAATACCGA
GTTTGAGGTCGCTGTCTCGGTGCATGATTCGGTCTATAGCACCGACTTCGCATCCGTCGTTCTTCCCTATGACCC
CAACGATCCTGAAAAGAATGCCAAAACTATCGAACAATACATCCTTCAAGTCCTGCGCAGGTTTTCTGTCGAGCA
TCTATGCAAGTTTCTGGGTGCTGGTGTCACGCTTACTCTCCTCAAAGAGGTGGGTCGTCATCTTCGATTCGCAGC
GAACTCGATCTCATGTCTCTCAGGTTCCTAACGTCTGCACGAGACTTTGGCTAGATCTAGACATCGTTCCTTTCG
TGTTCAATATCAAACAGTATCACACTGATTCTCTGACGCGGCCCAACATCAAACACCGCATCTCATCTACTACTG
GCTCCTACGTTCCATCTGGAGCCGAGACGCCTACGGTGTACGTTGACTCTGCCCATCTGAAAGCGATGTCGGGTC
TTCAGACAGGTGTCTCTGGGCGTCTCCCCATCCAACGCACACTTGACGAACAGGCTGACTCCGCCGCTCGCAAAT
GTCTTATGAATTTTGGACCTGGAAATAATCCTCGCTTGAACATTGGACCTCGCAATCAAGTTCTAGTCGATGATG
GTGGTCGAGTCCACCTTCTTGACGATCTTGACGAATATAGAAACACCGTTGGACCAAGGTTAGTGTATTTTATCT
TTGTGCAACATAATTAAATCTGCTCTTCGTAAGGACCTGGAACGCTGTCATTAAGCTCGCTGATGAACTCCGAGA
GAAAAAAGTGAAGATCGGTTTCTTTTCTTCTACACCCCAAGGAGGTAAGACCTTTTGTATATGTCGCTCTTGCAA
CATCTAATACTTCTTATTAGGTGGTGTTGCCCTCGTAAGTAATTCTGTTTGTCCAATGCCATGCCTAACTGTGCC
TTGTTGAACATCAGATGAGGCATGCCTTGATCCGTTTTCTCACAGCTTTGGACGTGGATGCGGCTTGGTAAACCT
TTAATATTATTGTAGATGTAAACTTATCGCTCTTCTACTTCAGGTATGTACCGAATCCATCCCCTGCAGTGTTTC
GAACAACCAAAAACAACCACAACATCCTGCAAGGCGTTGCGGCTCCGGACCTACGTCTGACGGAAGAAGCCAGAG
ATGCATTCGATGCTTGGATCTTGAAGAATGGATTGCGCTGGACAGCAGAAGGCGGCCCCTTGGCTCGTGGTGGCG
TTGATGTGGCGTTCATCGGTTGGTCTTTTAATTGTGTTTCTCATACTCGGATATCTAAATAGCTTCGACGTTACA
GATGACCCTCAGATGCCGGGTCTGATCCCTTTGATCAAGAAAATTAGGCCAGAACTTCCAATCGTTTATCGGTCT
CATATTGAAATCCGAAGTGATCTCGTTCACGTTCCCGGGTCACCGCAAGAAGAGGTCTGGAAGTATCTGTGGAAA
AATATACAGCTGGCCGATCTCTTCATAAGCAAGTCATCATACTTACCGCGTTTGTTACATGCCGTCATGCTGAAT
ATTTGTAGGTCACCCGGTCAGCAAATTTGTCCCACAAGACGTTCCACTTGAGAAGGTCGCTCTTCTCGGAGCGGC
GACTGACTGGTTGGATGGCCTGAATAAGGATCTGGATCCCTGGTATGTGGTAATAAGGAATTATATTTCAACAAC
TGACGACTTGCTTCAGGGATTCTCAGTATTATATGGGAGAATTCCGCGCCCTCTGTGCCAGAGAAAGAATGCTTG
AGCTCAGGTGGCCTCAACGCGATTATATCATCCAAGTCGCCCGGTTTGATCCCTCGAAGGGTCGGTATTTGTTTT
GTTTTGTCGCCTAGTGGCATACTCTAACGATCACGAAAGGCATACCTAATGTCATTGACTCTTACGTCAAATTCC
GCGAGCTTCTCAAGCTGAAGTCTCCAGAACTTGAGGACGAAGATCATCCTCAGCTGTTGGTCTGTGGTCATGGAG
CTGTTGATGATCCAGACGCCAGTATCATCTATGATCAAATCATGCAAATTGTCAATTCTGAACCGTACGAGGCGT
ATGCGAAAGATATTGTCGTCATGCGCTTGCCACCCAGCGATCAATGTAAGCTGCCCTCCGCAAGTGTCGTCTGTT
GATCGTGCATCTGACAGTGTACAGTGCTCAATTCCCTGATGTCCAATGCTAAGATCGCTTTGCAACTGTCGACTC
GTGAAGGTTTCGAAGTGAAGGTTTCCGAGGCTCTTCATACAGGGAAACCTGTCATTGCTTCGAGAACTGGTGGGA
TTCCGCTTCAGATTGAGCACGGTAAATCCGGCTATCTTTGCACCCCGGGCGACAATGAAGCTGTTGCTGGACATC
TCTATGACCTCTATACGGATGAAATCCTTTACAAGACGATGAGCGACTACGCCAAGACCCACGTTTCCGATGAAG
TTGGGACTGTTGGGAATACTGCTGCTTGGTTGTACTTGGCTGTTATGTACAATCGCGGCATCAAGATCAAGCCCA
ACGGTGCTTGGCTCAATGACCTCCTTCGAACAGAGACAGGAGAGGATTATGAAGAAGGAGAACCGAGACTGCCGC
GTGGGGGATTAAAAATGCAAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail