Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061690
Gene name
Locationscaffold_03b:309123..310148
Strand+
Gene length (bp)1025
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 56 128 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061690
MKVVNFGLFPALFFGGAAAVAVVAPKHGHNSFHHRDIANRTDESAHWKRVEHARWTFYDVGLGACGKTNVPSDFI
VALNSPQFGGGYPGPHCFQTITMKYGGKTAKAQIMDQCPGCPYGGLDLSRGLFDFFASEDLGVIYGSWSFGDSGG
DDGDDDPPKPTTTKRHHTTSKEKPTTTEKPEHTTSSKHRSTTSTVPSTTSTSSTPTSTSTSTEPSATSTSTSSDG
PANLNKFVLALDTLGGLVVAGSRLD*
Coding >Agabi119p4|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGATGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTCGGTGCATGCGGCAAGACCAATGTCCCGTCGGATTTTATC
GTCGCCTTGAATTCACCTCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATAT
GGTGGTAAAACAGCCAAGGCGCAAATTATGGACCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGA
GGGCTTTTCGACTTTTTCGCCTCTGAAGACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGT
GACGATGGGGACGACGACCCCCCCAAACCCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACT
ACAACTGAAAAGCCAGAGCATACCACGTCTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGC
ACAAGTAGTACACCCACCTCAACATCAACATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGC
CCTGCGAACTTGAACAAATTTGTACTTGCACTTGATACGTTGGGCGGCCTTGTCGTTGCTGGCAGCCGGCTTGAT
TGA
Transcript >Agabi119p4|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGATGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTCGGTGCATGCGGCAAGACCAATGTCCCGTCGGATTTTATC
GTCGCCTTGAATTCACCTCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATAT
GGTGGTAAAACAGCCAAGGCGCAAATTATGGACCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGA
GGGCTTTTCGACTTTTTCGCCTCTGAAGACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGT
GACGATGGGGACGACGACCCCCCCAAACCCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACT
ACAACTGAAAAGCCAGAGCATACCACGTCTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGC
ACAAGTAGTACACCCACCTCAACATCAACATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGC
CCTGCGAACTTGAACAAATTTGTACTTGCACTTGATACGTTGGGCGGCCTTGTCGTTGCTGGCAGCCGGCTTGAT
TGA
Gene >Agabi119p4|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGATGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTGTGAGTCGCTTTGTCTTTGGTTGGAAATCTTGTCAGAATT
GGATCCATCCGGGACTTTGTTTTCGAGTTCAGGAAACCTATACTAACACTATGCTTGGTGCAGCGGTGCATGCGG
CAAGACCAATGTCCCGTCGGATTTTGTGAGTAATTACGACTAGTTCTCTGTTTCAGCCACTTGAATAATTTCCAT
CGTGTTAGATCGTCGCCTTGAATTCACCTGTACGTGATTTCTCGCGTTTTCACCTGATTATAGATTGTTAAACGA
GCAACACAGCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATATGGTGGTAAA
ACAGCCAAGGCGCAAATTATGGACCAGGTGTGTCAAAGGCATAAACCAAATCTGAACCGCGAGAGATTGACATGG
ATTTTCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGAGGGCTTTTCGACTTTTTCGCCTCTGAAG
ACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGTGACGATGGGGACGACGACCCCCCCAAAC
CCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACTACAACTGAAAAGCCAGAGCATACCACGT
CTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGCACAAGTAGTACACCCACCTCAACATCAA
CATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGCCCTGCGAACTTGAACAAATTTGTACTTG
CACTTGATACGTTGGGCGGCCTTGTCGTTGCTGGCAGCCGGCTTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail