Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061630
Gene name
Locationscaffold_03b:291583..293558
Strand-
Gene length (bp)1975
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04142 Nuc_sug_transp Nucleotide-sugar transporter 3.7E-08 109 183
PF08449 UAA UAA transporter family 2.6E-06 113 369

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5RFT1|S35F6_PONAB Solute carrier family 35 member F6 OS=Pongo abelii GN=SLC35F6 PE=2 SV=1 9 398 1.0E-55
sp|Q8N357|S35F6_HUMAN Solute carrier family 35 member F6 OS=Homo sapiens GN=SLC35F6 PE=1 SV=1 9 371 4.0E-55
sp|Q5RKH7|S35F6_RAT Solute carrier family 35 member F6 OS=Rattus norvegicus GN=Slc35f6 PE=2 SV=1 9 403 5.0E-51
sp|Q8VE96|S35F6_MOUSE Solute carrier family 35 member F6 OS=Mus musculus GN=Slc35f6 PE=1 SV=1 9 371 7.0E-48
sp|Q09875|YAGC_SCHPO Uncharacterized protein C12G12.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.12 PE=4 SV=1 14 375 9.0E-46

GO

GO Term Description Terminal node
GO:0000139 Golgi membrane Yes
GO:0015165 pyrimidine nucleotide-sugar transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0071705 nitrogen compound transport No
GO:0005338 nucleotide-sugar transmembrane transporter activity No
GO:0016020 membrane No
GO:0031224 intrinsic component of membrane No
GO:0031090 organelle membrane No
GO:1901264 carbohydrate derivative transport No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0071702 organic substance transport No
GO:0015931 nucleobase-containing compound transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0015780 nucleotide-sugar transmembrane transport No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0098588 bounding membrane of organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 106 128 22
3 132 154 22
4 161 183 22
5 213 232 19
6 245 267 22
7 292 314 22
8 346 368 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061630
MPSSLYVPVLLAGMIITGSSNSLWSKWQDMQCVENCSDLNPARHVLYEQPVWQTLQMFLGETLCFLPILYAWLKF
KVQPVQLQDESEPLVAKDSQDSDPALEGWKVFLLWIPAACDLTGTTLMNVGLIYTPVSIYQMTRGALVLFVGVFS
VIFLRRRLWLYQWLSLIIVMTGVALVGYSGSLVKDVIKESLFGIKPTYASAQEAEDAQVGKVLVGVFFILFAQVF
TATQFVVEEMIMARYSVSPLLAVGYEGLFGATSILLLFPILSIPSVSTITPFFDLPRGWHQTINTPTVFWSGIAI
AISISLFNFFGLSVTRHVSATARSLTDTCRTLAIWIVSLGLGWERFVVPFSFLQVLGFSLLVYGTFLFNDLVAIP
ACLPKPPVHEQRDSESQELLRPSLDETATLPADLGQSGYDVVPEGQHAVLPSSRQAVASPGTAKQPF*
Coding >Agabi119p4|061630
ATGCCCTCCTCTCTCTATGTGCCCGTCCTGCTTGCAGGCATGATCATCACCGGCTCCAGCAATTCTCTCTGGAGC
AAGTGGCAGGACATGCAATGCGTCGAGAACTGCAGCGACCTCAACCCAGCCCGTCATGTCCTCTACGAACAGCCA
GTTTGGCAAACACTCCAGATGTTCCTCGGAGAAACGCTATGCTTCTTGCCAATCCTCTATGCCTGGCTCAAGTTC
AAAGTTCAACCGGTCCAGCTCCAAGATGAATCAGAACCCCTCGTGGCAAAGGACTCCCAAGATTCCGATCCGGCC
CTCGAGGGTTGGAAGGTCTTTCTGTTATGGATTCCTGCTGCGTGTGACCTCACTGGCACTACGTTGATGAATGTC
GGCTTGATCTATACACCTGTTTCCATTTATCAGATGACTCGTGGCGCTCTCGTGCTTTTTGTTGGTGTTTTTAGC
GTCATCTTCTTGCGTCGTCGTCTTTGGCTTTATCAATGGCTTTCTCTTATCATCGTCATGACCGGTGTTGCTCTC
GTTGGTTACAGCGGGTCTTTAGTCAAAGATGTTATCAAAGAGAGCTTATTTGGTATCAAACCCACATATGCTAGT
GCTCAAGAGGCCGAAGATGCCCAGGTCGGCAAAGTCCTCGTCGGTGTATTTTTCATTCTGTTTGCACAAGTCTTT
ACTGCCACTCAATTCGTGGTTGAAGAAATGATTATGGCTCGCTACTCTGTCAGTCCGTTGCTTGCCGTAGGCTAC
GAAGGATTATTTGGTGCAACCTCGATCTTGCTTTTATTCCCCATTCTGTCTATTCCGTCCGTCTCGACCATCACA
CCCTTCTTCGATCTTCCACGTGGATGGCATCAAACCATTAACACTCCCACAGTATTCTGGTCAGGTATTGCCATT
GCGATTAGTATCTCATTGTTCAATTTCTTTGGACTGAGTGTTACTCGCCATGTAAGTGCAACCGCTCGCTCTTTG
ACCGACACTTGCAGGACCCTCGCCATCTGGATTGTCAGCTTAGGCCTAGGTTGGGAAAGATTTGTAGTCCCCTTT
TCATTTTTACAAGTCCTCGGTTTCTCTCTTCTTGTCTACGGCACGTTCCTCTTCAATGATCTGGTTGCGATACCC
GCTTGCCTTCCGAAACCACCGGTACATGAACAGCGGGATTCAGAATCTCAGGAATTACTGCGGCCTTCCCTCGAT
GAAACAGCGACTTTACCCGCGGACTTAGGACAAAGTGGATATGATGTCGTACCAGAGGGTCAACATGCTGTTTTG
CCGTCTTCACGTCAGGCTGTTGCTTCACCTGGTACAGCGAAGCAGCCTTTTTAA
Transcript >Agabi119p4|061630
ATGCCCTCCTCTCTCTATGTGCCCGTCCTGCTTGCAGGCATGATCATCACCGGCTCCAGCAATTCTCTCTGGAGC
AAGTGGCAGGACATGCAATGCGTCGAGAACTGCAGCGACCTCAACCCAGCCCGTCATGTCCTCTACGAACAGCCA
GTTTGGCAAACACTCCAGATGTTCCTCGGAGAAACGCTATGCTTCTTGCCAATCCTCTATGCCTGGCTCAAGTTC
AAAGTTCAACCGGTCCAGCTCCAAGATGAATCAGAACCCCTCGTGGCAAAGGACTCCCAAGATTCCGATCCGGCC
CTCGAGGGTTGGAAGGTCTTTCTGTTATGGATTCCTGCTGCGTGTGACCTCACTGGCACTACGTTGATGAATGTC
GGCTTGATCTATACACCTGTTTCCATTTATCAGATGACTCGTGGCGCTCTCGTGCTTTTTGTTGGTGTTTTTAGC
GTCATCTTCTTGCGTCGTCGTCTTTGGCTTTATCAATGGCTTTCTCTTATCATCGTCATGACCGGTGTTGCTCTC
GTTGGTTACAGCGGGTCTTTAGTCAAAGATGTTATCAAAGAGAGCTTATTTGGTATCAAACCCACATATGCTAGT
GCTCAAGAGGCCGAAGATGCCCAGGTCGGCAAAGTCCTCGTCGGTGTATTTTTCATTCTGTTTGCACAAGTCTTT
ACTGCCACTCAATTCGTGGTTGAAGAAATGATTATGGCTCGCTACTCTGTCAGTCCGTTGCTTGCCGTAGGCTAC
GAAGGATTATTTGGTGCAACCTCGATCTTGCTTTTATTCCCCATTCTGTCTATTCCGTCCGTCTCGACCATCACA
CCCTTCTTCGATCTTCCACGTGGATGGCATCAAACCATTAACACTCCCACAGTATTCTGGTCAGGTATTGCCATT
GCGATTAGTATCTCATTGTTCAATTTCTTTGGACTGAGTGTTACTCGCCATGTAAGTGCAACCGCTCGCTCTTTG
ACCGACACTTGCAGGACCCTCGCCATCTGGATTGTCAGCTTAGGCCTAGGTTGGGAAAGATTTGTAGTCCCCTTT
TCATTTTTACAAGTCCTCGGTTTCTCTCTTCTTGTCTACGGCACGTTCCTCTTCAATGATCTGGTTGCGATACCC
GCTTGCCTTCCGAAACCACCGGTACATGAACAGCGGGATTCAGAATCTCAGGAATTACTGCGGCCTTCCCTCGAT
GAAACAGCGACTTTACCCGCGGACTTAGGACAAAGTGGATATGATGTCGTACCAGAGGGTCAACATGCTGTTTTG
CCGTCTTCACGTCAGGCTGTTGCTTCACCTGGTACAGCGAAGCAGCCTTTTTAA
Gene >Agabi119p4|061630
ATGCCCTCCTCTCTCTATGTGCCCGTCCTGCTTGCAGGCATGATCATCACCGTGCGTCGCCTTGAGCGAGTCTCT
GTTCTCGCTGACCGGTTCTCTTCAGGGCTCCAGCAATTCTCTCTGGAGCAAGTGGCAGGTTGGTTCGACAGCCAT
GTCATATTGGATCACATTAATTTCCGTCACATTCAACTAGGACATGCAATGCGTCGAGAACTGCAGCGACCTCAA
CCCAGCCCGTCATGTCCTCTACGAACAGCCAGTTTGGCAAACACTCCAGATGTTCCGTAAGTTCATTCTCGCCCA
AACATGGCTTCTCTCATCCTCACCCTCTGTTCCAGTCGGAGAAACGCTATGTTAGTCGCTACGCTTTAGTCCATC
TTCGCTTCATCTGAATGCCTCTAGGCTTCTTGCCAATCCTCTATGCCTGGCTCAAGTTCAAAGTTCAACCGGTCC
AGCTCCAAGATGAATCAGAACCCCTCGTGGCAAAGGACTCCCAAGATTCCGATCCGGCCCTCGAGGGTTGGAAGG
TCTTTCTGTTATGGATTCCTGCTGCGTGTGACCTCACTGGCACTACGGTCAGTCTTCCACGGGAAGCGCGGCCAC
TTTCATCTTACCCGACTCTCCGTTTAGTTGATGAATGTCGGCTTGATCTATACACCTGTTTCCATTTATCAGATG
ACTCGTGGCGCTCTCGTGCTTTTTGTTGGTGTTTTTAGCGTCATCTTCTTGCGTCGTCGTCTTTGGCTTTATCAG
TCAGTCTTCTGGCCCAGCTCTCCTGCGCTCGTAGTCACCGATATTACCTCAGATGGCTTTCTCTTATCATCGTCA
TGACCGGTGTTGCTCTCGTTGGTTACAGCGGGTCTTTAGTCAAAGATGTTATCAAAGAGAGCTTATTTGGTATCA
AACCCACATATGCTAGTGCTCAAGAGGCCGAAGATGCCCAGGTCGGCAAAGTCCTCGTCGGTCAGTCTTATCCTC
ATTTCACGGGACACCAGAATTAACTGACATCTTGTATGCCAGGTGTATTTTTCATTCTGTTTGCACAAGTCTTGT
AAGATCGACTAAAACCTTGATTGAAATTTTCTAACTTCGCATAGTACTGCCACTCAATTCGTGGTTGAAGGTGCG
TTAGTCATGCATAAGACTCAAGATCTATAACTCACTCTTTTTTACTCAGAAATGATTATGGGTAATGCAGTACTT
TCGTTTGCTTTCATTTCTGACATTGCTTGATATTTATTAGCTCGCTACTCTGTCAGTCCGTTGCTTGCCGTAGGC
TACGAAGGATTATTTGGTGCAACCTCGATCTTGCTTTTATTCCCCATTCTGTCTATTCCGTCCGTCTCGACCATC
ACACCCTTCTTCGATCTTCCACGTGGATGGCATCAAACCATTAACACTCCCACAGTATTCTGGTCAGGTATTGCC
ATTGCGATTAGTATCTCATTGTTCAATTTCTTTGGACTGAGTGTTACTCGCCATGTAAGTGCAACCGCTCGCTCT
TTGACCGACACTTGCAGGACCCTCGCCATCTGGATTGTCAGCTTAGGCCTAGGTTGGGAAAGATTTGTAGTCCCC
TTTTCATTTTTACAAGTCCTCGGTTTCTCTCTTCTTGTGTACGTGACGTCATTCAAGTCACCACAACCCTTTACT
GATCCAAACTTGATCAAAATGCAGCTACGGCACGGTAATTATTTTCACACAATTATATCATGCCTTATGGGTACT
AATTCTTCAACCGCAGTTCCTCTTCAATGATCTGGTTGCGATACCCGCTTGCCTTCCGAAACCACCGGTACATGA
ACAGCGGGATTCAGAATCTCAGGAATTACTGCGGCCTTCCCTCGATGAAACAGCGACTTTACCCGCGGACTTAGG
ACAAAGTGGATATGATGTCGTACCAGAGGGTCAACATGCTGTTTTGCCGTCTTCACGTCAGGCTGTTGCTTCACC
TGGTACAGCGAAGCAGCCTTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail