Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061620
Gene name
Locationscaffold_03b:287275..288928
Strand+
Gene length (bp)1653
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04925 SHQ1 SHQ1 protein 7.1E-66 237 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43076|SHQ1_SCHPO Protein shq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shq1 PE=3 SV=1 1 447 4.0E-80
sp|Q05B18|SHQ1_XENTR Protein SHQ1 homolog OS=Xenopus tropicalis GN=shq1 PE=2 SV=1 1 437 8.0E-70
sp|Q7TMX5|SHQ1_MOUSE Protein SHQ1 homolog OS=Mus musculus GN=Shq1 PE=1 SV=2 1 448 5.0E-61
sp|A1L1R0|SHQ1_DANRE Protein SHQ1 homolog OS=Danio rerio GN=shq1 PE=1 SV=1 1 447 2.0E-59
sp|P40486|SHQ1_YEAST Protein SHQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHQ1 PE=1 SV=1 1 420 2.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43076|SHQ1_SCHPO Protein shq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shq1 PE=3 SV=1 1 447 4.0E-80
sp|Q05B18|SHQ1_XENTR Protein SHQ1 homolog OS=Xenopus tropicalis GN=shq1 PE=2 SV=1 1 437 8.0E-70
sp|Q7TMX5|SHQ1_MOUSE Protein SHQ1 homolog OS=Mus musculus GN=Shq1 PE=1 SV=2 1 448 5.0E-61
sp|A1L1R0|SHQ1_DANRE Protein SHQ1 homolog OS=Danio rerio GN=shq1 PE=1 SV=1 1 447 2.0E-59
sp|P40486|SHQ1_YEAST Protein SHQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHQ1 PE=1 SV=1 1 420 2.0E-59
sp|Q6PI26|SHQ1_HUMAN Protein SHQ1 homolog OS=Homo sapiens GN=SHQ1 PE=1 SV=2 1 423 4.0E-58
sp|Q3MHH1|SHQ1_BOVIN Protein SHQ1 homolog OS=Bos taurus GN=SHQ1 PE=2 SV=1 1 405 3.0E-54
sp|Q9TYM6|SHQ1_CAEEL Protein SHQ1 homolog OS=Caenorhabditis elegans GN=Y48A5A.1 PE=3 SV=4 1 450 1.0E-31
sp|Q9VI74|SHQ1_DROME Protein SHQ1 homolog OS=Drosophila melanogaster GN=CG10055 PE=2 SV=1 273 448 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061620
MITPRFTCSQTYESVVVSVYCPSIRAADVEIHVDANLLSLHVNPYFLRLTFSHSLLEDDASSANYNPTSGYLTIT
LTKENKGQEFQDLDLLTRLLAPRKTKSGPMIEALPSEDNDEDKLVSQIDNLSLNKDELLEAVENDWQLPQQLPQD
LPSLETSVQKYYGFLNLHSGYFRHVVHTENEVNELGTDVESCPASERRRLRIQHEDDKWDEEYYMADYADDEYIQ
ELLNWVSPQLISNEDIQYTDEEKETMLRLPRKEYLASPLETHNIYLTLITLLFSYAYDSRTTQSDPTPESAWTIC
SLTPAFSALDPPNITTKDSRAFVLDEVTEILISSYRRVLAFPLYRSFALAEACQKDVARILCKGKRLLIRCLLEM
KQILDHHEVYYVYSKIWVDDFCSWVQSHASDETLKELGELMSKAKVVKSSIGWDLEELEAATLEATNREADSDDE
*
Coding >Agabi119p4|061620
ATGATCACGCCTCGCTTTACCTGCTCTCAAACGTACGAATCGGTCGTCGTTTCTGTATATTGTCCATCTATTCGT
GCCGCGGACGTCGAAATCCACGTCGACGCCAATCTGCTCTCGCTCCACGTCAATCCATACTTTCTGCGACTGACG
TTCTCCCATTCGCTTCTGGAAGATGATGCGTCCTCCGCAAATTATAATCCTACCTCGGGGTACCTCACGATTACG
CTCACAAAAGAAAACAAAGGTCAAGAATTTCAAGATTTAGACCTTTTGACCCGGCTCCTGGCTCCACGTAAGACC
AAATCAGGACCGATGATTGAAGCACTTCCTTCTGAGGACAACGATGAAGATAAACTCGTGTCACAGATTGACAAT
CTATCTTTAAACAAAGACGAATTACTAGAAGCGGTCGAAAACGATTGGCAGCTGCCCCAGCAACTTCCTCAAGAT
CTTCCTTCACTCGAAACCTCCGTTCAGAAGTATTATGGCTTTTTAAATCTGCATTCCGGATATTTCAGACACGTC
GTACATACGGAAAACGAGGTTAATGAACTAGGTACTGACGTCGAATCTTGTCCAGCTAGTGAAAGACGGAGACTC
CGGATCCAACATGAAGATGACAAGTGGGACGAAGAATACTATATGGCAGACTATGCAGATGATGAATATATCCAG
GAGCTGCTTAACTGGGTATCTCCACAGCTCATCTCCAATGAAGATATTCAGTACACAGACGAAGAAAAAGAAACA
ATGCTGCGTTTGCCTCGCAAAGAATATCTCGCGAGTCCATTAGAGACTCATAATATTTATCTCACTCTTATAACA
CTGCTTTTCTCGTACGCATATGATTCGCGGACAACTCAGTCGGACCCAACGCCGGAAAGTGCGTGGACGATTTGC
AGCTTAACACCGGCTTTTTCAGCGCTCGACCCACCCAATATCACAACCAAAGACTCCCGGGCCTTTGTACTTGAC
GAAGTAACAGAGATTCTTATATCCTCTTATAGACGAGTGCTTGCTTTTCCTCTATATCGTTCGTTCGCTTTGGCC
GAGGCTTGCCAAAAAGACGTGGCGCGCATTCTATGCAAAGGAAAAAGGCTTTTGATTCGGTGCCTGTTGGAAATG
AAGCAAATTCTTGACCACCATGAGGTGTACTACGTTTACAGCAAGATTTGGGTCGATGACTTCTGTTCATGGGTT
CAGAGTCATGCTAGCGACGAGACACTCAAAGAACTAGGAGAGTTAATGTCAAAGGCCAAGGTGGTGAAAAGCTCC
ATCGGTTGGGACTTGGAAGAGTTGGAGGCTGCCACCCTTGAGGCTACCAATCGGGAGGCTGACAGCGACGACGAA
TAA
Transcript >Agabi119p4|061620
ATGATCACGCCTCGCTTTACCTGCTCTCAAACGTACGAATCGGTCGTCGTTTCTGTATATTGTCCATCTATTCGT
GCCGCGGACGTCGAAATCCACGTCGACGCCAATCTGCTCTCGCTCCACGTCAATCCATACTTTCTGCGACTGACG
TTCTCCCATTCGCTTCTGGAAGATGATGCGTCCTCCGCAAATTATAATCCTACCTCGGGGTACCTCACGATTACG
CTCACAAAAGAAAACAAAGGTCAAGAATTTCAAGATTTAGACCTTTTGACCCGGCTCCTGGCTCCACGTAAGACC
AAATCAGGACCGATGATTGAAGCACTTCCTTCTGAGGACAACGATGAAGATAAACTCGTGTCACAGATTGACAAT
CTATCTTTAAACAAAGACGAATTACTAGAAGCGGTCGAAAACGATTGGCAGCTGCCCCAGCAACTTCCTCAAGAT
CTTCCTTCACTCGAAACCTCCGTTCAGAAGTATTATGGCTTTTTAAATCTGCATTCCGGATATTTCAGACACGTC
GTACATACGGAAAACGAGGTTAATGAACTAGGTACTGACGTCGAATCTTGTCCAGCTAGTGAAAGACGGAGACTC
CGGATCCAACATGAAGATGACAAGTGGGACGAAGAATACTATATGGCAGACTATGCAGATGATGAATATATCCAG
GAGCTGCTTAACTGGGTATCTCCACAGCTCATCTCCAATGAAGATATTCAGTACACAGACGAAGAAAAAGAAACA
ATGCTGCGTTTGCCTCGCAAAGAATATCTCGCGAGTCCATTAGAGACTCATAATATTTATCTCACTCTTATAACA
CTGCTTTTCTCGTACGCATATGATTCGCGGACAACTCAGTCGGACCCAACGCCGGAAAGTGCGTGGACGATTTGC
AGCTTAACACCGGCTTTTTCAGCGCTCGACCCACCCAATATCACAACCAAAGACTCCCGGGCCTTTGTACTTGAC
GAAGTAACAGAGATTCTTATATCCTCTTATAGACGAGTGCTTGCTTTTCCTCTATATCGTTCGTTCGCTTTGGCC
GAGGCTTGCCAAAAAGACGTGGCGCGCATTCTATGCAAAGGAAAAAGGCTTTTGATTCGGTGCCTGTTGGAAATG
AAGCAAATTCTTGACCACCATGAGGTGTACTACGTTTACAGCAAGATTTGGGTCGATGACTTCTGTTCATGGGTT
CAGAGTCATGCTAGCGACGAGACACTCAAAGAACTAGGAGAGTTAATGTCAAAGGCCAAGGTGGTGAAAAGCTCC
ATCGGTTGGGACTTGGAAGAGTTGGAGGCTGCCACCCTTGAGGCTACCAATCGGGAGGCTGACAGCGACGACGAA
TAA
Gene >Agabi119p4|061620
ATGATCACGCCTCGCTTTACCTGCTCTCAAACGTACGAATCGGTCGTCGTTTCTGTATATTGTCCATCTATTCGT
GTATGCCGCTACAACCGCCCTCTTCTTTTTTCACGTAACTGATGTTCAAGATCCCGATGTATGCCAAAGTAGGCC
GCGGACGTCGAAATCCACGTCGACGCCAATCTGCTCTCGCTCCACGTCAATCCATACTTTCTGCGACTGACGTTC
TCCCATTCGCTTCTGGAAGATGATGCGTCCTCCGCAAATTATAATCCTACCTCGGGGTACCTCACGATTACGCTC
ACAAAAGAAAACAAAGGTCAAGAATTTCAAGATTTAGACCTTTTGACCCGGCTCCTGGCTCCACGTAAGACCAAA
TCAGGACCGATGATTGAAGCACTTCCTTCTGAGGACAACGATGAAGATAAACTCGTGTCACAGATTGACAATCTA
TCTTTAAACAAAGACGAATTACTAGAAGGCAATCACTCCATTTCTGACATTATACCCTCACTCATTTAAGGATTC
AGCGGTCGAAAACGATTGGCAGCTGCCCCAGCAACTTCCTCAAGATCTTCCTTCACTCGAAACCTCCGTTCAGAA
GTATTATGGCTTTTTAAATCTGCATTCCGGATATTTCAGACACGTCGTACATACGGAAAACGAGGTTAATGAACT
AGGTACTGACGTCGAATCTTGTCCAGCTAGTGAAAGACGGAGACTCCGGATCCAACATGAAGATGACAAGTGGGA
CGAAGAATACTATATGTAAATGCGAAGACTTTGGACATATGACATTTAAAGGCTCATACGGGACGTTTAGGGCAG
ACTATGCAGATGATGAATATATCCAGGAGCTGCTTAACTGGGTATCTCCACAGCTCATCTCCAATGAAGATATTC
AGTACACAGACGAAGAAAAAGAAACAATGCTGCGTTTGCCTCGCAAAGAATGTAAGCCTTGGATCTTATATCATC
GAACTATCTAATCTCACCCATTGCGGAAAATTTTTCAAGATCTCGCGAGTCCATTAGAGACTCATAATATTTATC
TCACTCTTATAACACTGCTTTTCTCGTACGCATATGATTCGCGGACAACTCAGTCGGACCCAACGCCGGAAAGTG
CGTGGACGATTTGCAGCTTAACACCGGCTTTTTCAGCGCTCGACCCACCCAATATCACAACCAAAGACTCCCGGG
CCTTTGTACTTGACGAAGTAACAGAGATTCTTATATCCTCTTATAGACGAGTGCTTGCTTTTCCTCTATATCGTT
CGTTCGCTTTGGCCGAGGCTTGCCAAAAAGACGTGGCGCGCATTCTATGCAAAGGAAAAAGGCTTTTGATTCGGT
GCCTGTTGGAAATGAAGCAAATTCTTGACCACCATGAGGTGTACTACGTTTACAGCAAGATTTGGGTCGATGACT
TCTGTTCATGGGTTCAGAGTCATGCTAGGTTAGTTCAATCTTCTCACCTAACGCAACGCTGCATTTGTTGAACGG
TCTATTTCTCAAAGCGACGAGACACTCAAAGAACTAGGAGAGTTAATGTCAAAGGCCAAGGTGGTGAAAAGCTCC
ATCGGTTGGGACTTGGAAGAGTTGGAGGCTGCCACCCTTGAGGCTACCAATCGGGAGGCTGACAGCGACGACGAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail