Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061490
Gene name
Locationscaffold_03b:254506..257449
Strand-
Gene length (bp)2943
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 1.9E-141 73 687
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 1.3E-20 718 778

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 148 788 3.0E-103
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 114 788 6.0E-103
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 160 788 4.0E-102
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 160 788 5.0E-102
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 148 788 2.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 148 788 3.0E-103
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 114 788 6.0E-103
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 160 788 4.0E-102
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 160 788 5.0E-102
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 148 788 2.0E-101
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC PE=3 SV=1 64 788 8.0E-77
sp|Q9ZVH4|CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana GN=CUL3A PE=1 SV=1 45 788 1.0E-75
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul4 PE=1 SV=1 148 788 2.0E-73
sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 155 788 3.0E-73
sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 155 788 4.0E-73
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 155 788 4.0E-73
sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 155 788 5.0E-73
sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 155 788 6.0E-73
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 155 788 9.0E-73
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 SV=1 111 788 3.0E-72
sp|Q9C9L0|CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana GN=CUL3B PE=1 SV=1 45 788 4.0E-69
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3 PE=1 SV=2 71 788 1.0E-66
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 143 788 1.0E-65
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=culA PE=1 SV=1 242 788 1.0E-63
sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1 SV=1 152 788 2.0E-63
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=culB PE=2 SV=1 182 788 3.0E-59
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 244 788 2.0E-55
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 244 788 2.0E-55
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 244 788 2.0E-55
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 223 788 3.0E-55
sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4 PE=1 SV=3 142 788 8.0E-55
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul1 PE=1 SV=1 111 784 1.0E-54
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 223 788 2.0E-54
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 223 788 2.0E-54
sp|Q9SRZ0|CUL2_ARATH Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1 435 788 2.0E-54
sp|P0CH31|CLL1_ARATH Putative cullin-like protein 1 OS=Arabidopsis thaliana GN=At1g43140 PE=3 SV=1 152 788 1.0E-50
sp|Q9JJ31|CUL5_RAT Cullin-5 OS=Rattus norvegicus GN=Cul5 PE=1 SV=3 141 788 3.0E-48
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 182 788 9.0E-48
sp|Q9D5V5|CUL5_MOUSE Cullin-5 OS=Mus musculus GN=Cul5 PE=1 SV=3 141 788 2.0E-47
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 182 788 2.0E-47
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster GN=Cul1 PE=1 SV=2 244 788 2.0E-46
sp|Q29425|CUL5_RABIT Cullin-5 OS=Oryctolagus cuniculus GN=CUL5 PE=2 SV=3 182 788 5.0E-46
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1 PE=1 SV=1 235 788 8.0E-44
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=culE PE=3 SV=1 242 776 1.0E-41
sp|Q23639|CUL5_CAEEL Cullin-5 OS=Caenorhabditis elegans GN=cul-5 PE=1 SV=2 235 788 3.0E-39
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6 PE=1 SV=1 117 788 6.0E-39
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2 PE=1 SV=3 244 788 1.0E-36
sp|Q12018|CDC53_YEAST Cell division control protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC53 PE=1 SV=1 229 776 5.0E-35
sp|P53202|CUL3_YEAST Cullin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUL3 PE=1 SV=1 419 788 4.0E-28
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 475 672 2.0E-11
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 475 672 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0031625 ubiquitin protein ligase binding Yes
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0006807 nitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008150 biological_process No
GO:0019899 enzyme binding No
GO:0009057 macromolecule catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061490
MTSLSTLLTLPITSKGLSELKDSVSETNVPQNRSQAAAAATLSGSQKSGPLTLHLVGGNLVNKPPSGDKEFALLR
RAIRVVLNPDENEVLPASNYAIYSACHTIVSIVKKGEGLFDALQMELERCVGSLVRSCVESDKEKIEWLGFFVAT
CKWFETKINLLVSLLTYLDQEYIARNTNFKPIRETAYTIFQERIFVNPSIVERLKEGVEAWLTAERDTKLPHPSR
SHIPQLVNHLVVHSQYSEFENHYVSFTRTYYLEESQRLSDVYKTNPQAFFRHVQNRIKEEEDRSKAVLPVGSWGL
LRETSERALWRERLEWLANETVGPYMDAKDFQSLEAMYELFGRVDGLKVLCAAFRKFIRTSVETIVTDAARDEEL
VNRLLELKHIANETVSTSFSETTSSSLSSSKRTKLPDKNFVYGLGDSFTLGFKARRNKPAEMIAKHLDKAMRKGQ
GKSSDAEFDAMLDDVLGLYRFSEDKDVFRTFYHRSLAKRLLLSKSASDDFEASMLKNLKEKYDPEFGMGEDMFKD
LALSRESMRDYHSKLDVDSPGRKLNVMVLQRSAWPFSKNEKKFDLPPDMKEELNRFTLYYKTKHSGRALFWDHSL
GTATLKASFLPGNKELSVSLYQAAVLLLFNQSPQISFQDIKSQTEMDDAELRRTLQSLACGKKKVLKKIPPGKDV
NDDDVFKFNESFDDLRAKVHINSIQAKVSPEESKRTNEAIEGDRKLYLDAAIVRIMKASKTMTYEKLKTATIDAV
KNHFVPQVDIIKQRVDSLVEGDYLERDKTERNVFHYVA*
Coding >Agabi119p4|061490
ATGACGAGCCTATCGACGCTCTTGACTCTCCCGATAACGTCCAAAGGGCTCAGCGAATTAAAGGATTCTGTATCA
GAGACCAACGTGCCTCAGAATCGGTCCCAAGCTGCTGCCGCAGCAACTCTCTCTGGTTCACAAAAGTCCGGGCCT
CTGACTCTTCACCTTGTTGGAGGCAATTTGGTCAATAAGCCACCTTCGGGTGATAAGGAGTTCGCGCTGTTGCGT
CGAGCTATTCGCGTCGTTCTCAATCCAGATGAGAACGAGGTTCTGCCCGCCTCGAACTATGCTATTTACTCTGCC
TGTCACACCATCGTCAGCATCGTAAAGAAGGGTGAAGGACTGTTTGATGCGTTGCAGATGGAATTGGAGAGATGC
GTAGGATCGCTAGTCAGGTCTTGCGTGGAGAGTGATAAGGAGAAGATTGAGTGGCTTGGTTTCTTCGTCGCGACT
TGTAAATGGTTTGAGACCAAAATCAATCTCCTTGTTTCGTTACTCACGTATTTGGACCAAGAATATATCGCAAGA
AACACTAATTTCAAACCCATTCGAGAAACCGCGTACACTATTTTCCAAGAAAGGATCTTTGTAAATCCATCCATA
GTCGAAAGGCTGAAGGAAGGCGTAGAAGCATGGCTGACGGCAGAGCGCGACACGAAATTGCCGCATCCCAGTCGC
TCACACATTCCGCAACTAGTCAATCACCTCGTCGTACACAGTCAATACTCCGAATTCGAAAACCACTACGTGTCT
TTCACACGTACTTATTACTTGGAGGAATCTCAGCGACTCTCGGACGTGTATAAGACCAACCCTCAGGCTTTCTTC
AGACATGTCCAGAATAGAATTAAAGAGGAAGAAGACAGAAGTAAAGCTGTTTTGCCTGTCGGTAGCTGGGGTTTA
CTGAGAGAGACGAGCGAGCGAGCATTGTGGCGTGAACGATTGGAATGGCTCGCCAACGAGACTGTGGGTCCATAT
ATGGATGCAAAAGATTTCCAATCCTTGGAAGCAATGTATGAGCTCTTTGGTCGGGTTGATGGTCTCAAGGTTCTC
TGTGCTGCTTTCCGTAAATTCATCCGGACCAGTGTTGAAACCATAGTCACAGATGCAGCGCGTGATGAAGAGCTC
GTTAATCGCCTACTTGAACTCAAGCACATCGCCAACGAAACTGTTTCCACATCCTTTTCTGAAACCACGTCATCC
TCCCTTTCGTCGTCAAAACGTACCAAACTACCAGACAAGAATTTCGTTTATGGATTAGGGGATTCTTTCACGCTT
GGGTTCAAAGCGCGTCGTAACAAACCAGCTGAGATGATTGCGAAGCATCTGGATAAGGCTATGCGGAAAGGTCAA
GGAAAGAGCAGTGATGCTGAATTTGATGCAATGTTGGACGACGTGTTGGGTTTGTATCGCTTCTCAGAAGATAAG
GATGTCTTCAGGACATTCTATCATCGGAGTCTGGCCAAGAGACTACTGTTGTCAAAGAGTGCCTCCGATGACTTT
GAGGCGAGCATGCTCAAGAATCTCAAAGAAAAATACGATCCCGAGTTTGGCATGGGAGAGGACATGTTCAAGGAT
CTCGCACTTTCAAGAGAGAGTATGCGAGATTATCACTCCAAATTGGATGTAGATAGTCCCGGGCGGAAGTTGAAC
GTTATGGTTCTACAACGAAGTGCCTGGCCTTTTAGCAAGAACGAGAAAAAGTTTGACCTACCTCCTGACATGAAA
GAAGAACTTAACAGGTTTACGTTGTATTACAAGACGAAGCACTCGGGTCGTGCACTTTTCTGGGATCATAGCTTA
GGAACTGCGACTCTCAAAGCTAGTTTTTTGCCTGGTAACAAAGAGTTGTCCGTCAGTTTGTATCAAGCCGCGGTG
TTATTACTTTTCAATCAATCGCCGCAAATTTCATTCCAGGACATCAAAAGTCAAACCGAGATGGATGATGCAGAA
TTGCGAAGAACTTTGCAGAGTTTAGCTTGTGGAAAGAAGAAAGTGTTGAAAAAGATTCCGCCGGGAAAAGATGTG
AACGATGATGATGTGTTTAAATTCAATGAATCCTTTGACGATCTTCGAGCAAAAGTCCATATCAACTCTATCCAA
GCCAAAGTTTCTCCTGAAGAGTCGAAGAGAACCAACGAAGCTATTGAAGGCGACAGGAAACTTTACCTCGATGCT
GCGATTGTACGGATTATGAAGGCTAGCAAGACTATGACATATGAGAAACTGAAGACTGCGACTATTGATGCTGTG
AAGAATCATTTCGTGCCGCAAGTGGATATCATCAAACAGAGGGTTGATTCGCTTGTGGAAGGGGATTATTTGGAG
AGGGATAAGACTGAAAGGAATGTATTTCATTATGTTGCTTGA
Transcript >Agabi119p4|061490
ATGACGAGCCTATCGACGCTCTTGACTCTCCCGATAACGTCCAAAGGGCTCAGCGAATTAAAGGATTCTGTATCA
GAGACCAACGTGCCTCAGAATCGGTCCCAAGCTGCTGCCGCAGCAACTCTCTCTGGTTCACAAAAGTCCGGGCCT
CTGACTCTTCACCTTGTTGGAGGCAATTTGGTCAATAAGCCACCTTCGGGTGATAAGGAGTTCGCGCTGTTGCGT
CGAGCTATTCGCGTCGTTCTCAATCCAGATGAGAACGAGGTTCTGCCCGCCTCGAACTATGCTATTTACTCTGCC
TGTCACACCATCGTCAGCATCGTAAAGAAGGGTGAAGGACTGTTTGATGCGTTGCAGATGGAATTGGAGAGATGC
GTAGGATCGCTAGTCAGGTCTTGCGTGGAGAGTGATAAGGAGAAGATTGAGTGGCTTGGTTTCTTCGTCGCGACT
TGTAAATGGTTTGAGACCAAAATCAATCTCCTTGTTTCGTTACTCACGTATTTGGACCAAGAATATATCGCAAGA
AACACTAATTTCAAACCCATTCGAGAAACCGCGTACACTATTTTCCAAGAAAGGATCTTTGTAAATCCATCCATA
GTCGAAAGGCTGAAGGAAGGCGTAGAAGCATGGCTGACGGCAGAGCGCGACACGAAATTGCCGCATCCCAGTCGC
TCACACATTCCGCAACTAGTCAATCACCTCGTCGTACACAGTCAATACTCCGAATTCGAAAACCACTACGTGTCT
TTCACACGTACTTATTACTTGGAGGAATCTCAGCGACTCTCGGACGTGTATAAGACCAACCCTCAGGCTTTCTTC
AGACATGTCCAGAATAGAATTAAAGAGGAAGAAGACAGAAGTAAAGCTGTTTTGCCTGTCGGTAGCTGGGGTTTA
CTGAGAGAGACGAGCGAGCGAGCATTGTGGCGTGAACGATTGGAATGGCTCGCCAACGAGACTGTGGGTCCATAT
ATGGATGCAAAAGATTTCCAATCCTTGGAAGCAATGTATGAGCTCTTTGGTCGGGTTGATGGTCTCAAGGTTCTC
TGTGCTGCTTTCCGTAAATTCATCCGGACCAGTGTTGAAACCATAGTCACAGATGCAGCGCGTGATGAAGAGCTC
GTTAATCGCCTACTTGAACTCAAGCACATCGCCAACGAAACTGTTTCCACATCCTTTTCTGAAACCACGTCATCC
TCCCTTTCGTCGTCAAAACGTACCAAACTACCAGACAAGAATTTCGTTTATGGATTAGGGGATTCTTTCACGCTT
GGGTTCAAAGCGCGTCGTAACAAACCAGCTGAGATGATTGCGAAGCATCTGGATAAGGCTATGCGGAAAGGTCAA
GGAAAGAGCAGTGATGCTGAATTTGATGCAATGTTGGACGACGTGTTGGGTTTGTATCGCTTCTCAGAAGATAAG
GATGTCTTCAGGACATTCTATCATCGGAGTCTGGCCAAGAGACTACTGTTGTCAAAGAGTGCCTCCGATGACTTT
GAGGCGAGCATGCTCAAGAATCTCAAAGAAAAATACGATCCCGAGTTTGGCATGGGAGAGGACATGTTCAAGGAT
CTCGCACTTTCAAGAGAGAGTATGCGAGATTATCACTCCAAATTGGATGTAGATAGTCCCGGGCGGAAGTTGAAC
GTTATGGTTCTACAACGAAGTGCCTGGCCTTTTAGCAAGAACGAGAAAAAGTTTGACCTACCTCCTGACATGAAA
GAAGAACTTAACAGGTTTACGTTGTATTACAAGACGAAGCACTCGGGTCGTGCACTTTTCTGGGATCATAGCTTA
GGAACTGCGACTCTCAAAGCTAGTTTTTTGCCTGGTAACAAAGAGTTGTCCGTCAGTTTGTATCAAGCCGCGGTG
TTATTACTTTTCAATCAATCGCCGCAAATTTCATTCCAGGACATCAAAAGTCAAACCGAGATGGATGATGCAGAA
TTGCGAAGAACTTTGCAGAGTTTAGCTTGTGGAAAGAAGAAAGTGTTGAAAAAGATTCCGCCGGGAAAAGATGTG
AACGATGATGATGTGTTTAAATTCAATGAATCCTTTGACGATCTTCGAGCAAAAGTCCATATCAACTCTATCCAA
GCCAAAGTTTCTCCTGAAGAGTCGAAGAGAACCAACGAAGCTATTGAAGGCGACAGGAAACTTTACCTCGATGCT
GCGATTGTACGGATTATGAAGGCTAGCAAGACTATGACATATGAGAAACTGAAGACTGCGACTATTGATGCTGTG
AAGAATCATTTCGTGCCGCAAGTGGATATCATCAAACAGAGGGTTGATTCGCTTGTGGAAGGGGATTATTTGGAG
AGGGATAAGACTGAAAGGAATGTATTTCATTATGTTGCTTGA
Gene >Agabi119p4|061490
ATGACGAGCCTATCGACGCTCTTGACTCTCCCGATAACGTCCAAAGGGCTCAGCGAATTAAAGGATTCTGTATCA
GAGACCAACGTGCCTCAGAATCGGTCTGCATCTCGTCGCAAAGTGCCTCGGTTGAACACCGACTCTGATGCCGCA
TCTACTTCCAGGTCCCAAGCTGCTGCCGCAGCAACTCTCTCTGGTTCACAAAAGTCCGGGCCTCTGACTCTTCAC
CTTGTTGGAGGCAATTTGGGTGGGTCTTAGCAGTACTTTGTCTGGTACACAGTTTCTGATGCCATATGTTCAGTC
AATAAGCCACCTTCGGGTGATAAGGAGTTCGCGCTGTTGCGTCGAGCTATTCGCGTCGTTCTCAATCCAGATGAG
AACGAGGTTCTGCCCGCCTCGAACTATGCTATTTACTCTGCCTGTCACACCATCGTCAGCATCGTAAAGAAGGGT
GAAGGACTGTTTGATGCGTTGCAGATGGAATTGGAGAGATGCGTAGGATCGCTAGTCAGGTCTTGCGTGGAGAGT
GATAAGGAGAAGATTGAGTGGCTTGGTTTCTTCGTCGCGACTTGTAAATGGTTTGAGACCAAAATCGTAAGAGTT
CTTGTCCTCTACGTGGTTGATCTGGAGTGGTTTACAACTCTCCCTCCCTTAGAATCTCCTTGTTTCGTTACTCAC
GTATTTGGACCAAGAATATATCGCAAGAAACACTAATTTCAAACCCATTCGAGAAACCGCGTACACTATTTTCCA
AGAAAGGATCTTTGTAAATCCATCCATAGTCGAAAGGCTGAAGGAAGGCGTAGAAGCATGGCTGACGGCAGAGCG
CGACACGAAGTGCGTATCTTTATCATAATCAATGCATCCATGTTCACAACAATTTCGTCCTATTAGATTGCCGCA
TCCCAGTCGCTCACACATTCCGCAACTAGTCAATCACCTCGTCGTACACAGTCAATACTCCGAATTCGAAAACCA
CTACGTGTCTTTCACACGTACTTATTACTTGGAGGAATCTCAGCGACTCTCGGACGTGTATAAGACCAACCCTCA
GGCTTTCTTCAGACATGTCCAGAATAGAATTAAAGAGGAAGAAGACAGAAGTAAAGCTGTTTTGCCTGTCGGTAG
CTGGGGTTTACTGAGAGAGACGAGCGAGCGAGCATTGTGGCGTGAACGATTGGAATGGCTCGCCAACGAGAGTGA
GTTATTTGCCCCGGGATTAATCTCGCTATGTAACCATTGCATCTTTAGCTGTGGGTCCATATATGGATGCAAAAG
ATTTCCAATCCTTGGAAGCAATGTATGAGCTCTTTGGTCGGGTTGATGGTCTCAAGGTTCTCTGTGCTGCTTTCC
GTAAATTCATCCGGGTATGCTTTCAAAATTACTCTTGATTAAATGTACCCACCTGATTGGCCTGCTCAGACCAGT
GTTGAAACCATAGTCACAGATGCAGCGCGTGATGAAGAGCTCGTTAATCGCCTACTTGAACTCAAGCACATCGCC
AACGAAACTGTTTCCACATCCTTTTCTGAAACCACGTCATCCTCCCTTTCGTCGTCAAAACGTACCAAACTACCA
GACAAGAATTTCGTTTATGGATTAGGGGATTCTTTCACGCTTGGGTTCAAAGCGCGTCGTAACAAACCAGCTGAG
ATGATTGCGAAGCATCTGGATAAGGCTATGCGGAAAGGTCAAGGAAAGAGCAGTGATGCTGAATTTGATGCAATG
TTGGACGACGTGTTGGGTTTGTATCGCTTCTCAGAAGATAAGGATGTCTTCAGGACATTCTATCATCGGAGTCTG
GCCAAGAGACTACTGTTGTCAAAGAGTGCCTCCGATGACTTTGAGGCGAGCATGCTCAAGAATCTCAAAGAAAGT
GCGTGTTTTGTAATGGGAAATGACTGTCACTGAAGGTTGTTTTGCAGAATACGATCCCGAGTTTGGCATGGGAGA
GGACATGTTCAAGGATCTCGCACTTTCAAGAGAGAGTATGCGAGATTATCACTCCAAATTGGATGTAGATAGTCC
CGGGCGGAAGTTGAACGTTATGGTTCTACAACGAAGTGCCTGGCCTTTTAGCAAGAACGAGAAAAAGTTTGACCT
ACCTCCTGACGTGAGGCAAAATCTCACTCCTTGTCTTGATCGTATCTAATGATCGAATTTCTAGATGAAAGAAGA
ACTTAACAGGTTTACGTTGTATTACAAGACGAAGCACTCGGGTCGTGCACTTTTCTGGGATCATAGCTTAGGAAC
TGCGACTCTCAAAGCTAGTTTTTTGCCTGGTAACAAAGAGTTGTCCGTCAGTTTGTATCAAGCCGCGGTGTTATT
ACTTTTCAATCAATCGCCGCAAATTTCATTCCAGGACATCAAAAGTCAAACCGAGATGGGTAAGAGTTCTCTTTC
ATGTTGGTTTTATGTTTTTAGGATATACATGATTAATGAGTTTTTGTTTCTTAAAGATGATGCAGAATTGCGAAG
AACTTTGCAGAGTTTAGCTTGTGGAAAGAAGAAAGTGTTGAAAAAGATTCCGCCGGGAAAAGATGTGAACGATGA
TGATGTGTTTAAATTCAATGAATCCTTTGACGATCTTCGAGCAAAAGTCCATATCAACTCTATCCAAGCCAAAGT
TTCTGTATGTTCACTCACATTTTTTTTTATCTCCGTGTCATTCTGACATGTATGATCAAATAGCCTGAAGAGTCG
AAGAGAACCAACGAAGCTATTGAAGGCGACAGGAAACTTTACCTCGATGCTGCGATTGTACGGATTATGAAGGCT
AGCAAGACTATGACATATGAGAAACTGAAGACTGCGACTATTGATGCTGTGAAGAATCATTTCGTGCCGCAAGTG
GATATCATCAAACAGAGGGTTGATTCGCTTGTGGAAGGGGATTATTTGGAGAGGGATAAGACTGAAAGGAATGTA
TTTCATTATGTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail