Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|061100
Gene name
Locationscaffold_03b:168551..171517
Strand-
Gene length (bp)2966
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00632 HECT HECT-domain (ubiquitin-transferase) 1.4E-89 535 836
PF00397 WW WW domain 1.0E-11 262 291
PF00397 WW WW domain 1.4E-12 361 390
PF00397 WW WW domain 1.7E-10 418 447
PF00168 C2 C2 domain 1.7E-20 11 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 7 838 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 7 838 0.0E+00
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 7 838 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 12 838 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 7 838 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 7 838 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 7 838 0.0E+00
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 7 838 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 12 838 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 7 838 0.0E+00
sp|Q4WTF3|RSP5_ASPFU Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hulA PE=3 SV=2 7 838 0.0E+00
sp|B0XQ72|RSP5_ASPFC Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hulA PE=3 SV=2 7 838 0.0E+00
sp|A1CQG2|RSP5_ASPCL Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hulA PE=3 SV=2 7 838 0.0E+00
sp|A2QQ28|RSP5_ASPNC Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hulA PE=3 SV=1 7 838 0.0E+00
sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 10 838 0.0E+00
sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 12 838 0.0E+00
sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 10 838 0.0E+00
sp|Q8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus GN=Itch PE=1 SV=2 8 838 0.0E+00
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 183 835 0.0E+00
sp|Q9DBH0|WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=1 SV=1 32 838 0.0E+00
sp|Q96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens GN=ITCH PE=1 SV=2 163 838 0.0E+00
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 185 835 0.0E+00
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 262 835 0.0E+00
sp|O00308|WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2 32 838 0.0E+00
sp|Q8BZZ3|WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus GN=Wwp1 PE=1 SV=2 187 838 2.0E-180
sp|P46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=4 212 835 2.0E-177
sp|Q9H0M0|WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens GN=WWP1 PE=1 SV=1 11 838 6.0E-176
sp|Q9Y0H4|SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster GN=Su(dx) PE=1 SV=1 213 838 1.0E-173
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 11 838 2.0E-172
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 265 835 9.0E-172
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 262 838 8.0E-171
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 262 838 3.0E-170
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 265 835 4.0E-170
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 262 838 1.0E-169
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 262 838 2.0E-168
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 324 836 5.0E-164
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 344 838 6.0E-161
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 406 838 2.0E-158
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 361 838 1.0E-157
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 342 838 4.0E-149
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 460 838 6.0E-122
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 460 838 8.0E-122
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 460 838 8.0E-118
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 460 838 2.0E-117
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 461 829 3.0E-106
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 463 836 2.0E-103
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 463 836 2.0E-103
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 463 836 4.0E-100
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 463 836 6.0E-100
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 450 836 2.0E-99
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 463 836 3.0E-98
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 463 836 1.0E-97
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 520 836 9.0E-93
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 486 830 3.0E-88
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 486 830 9.0E-88
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 486 830 4.0E-87
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 486 830 5.0E-86
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 486 830 6.0E-86
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 486 830 7.0E-86
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 486 830 1.0E-85
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 486 830 3.0E-84
sp|Q8CDU6|HECD2_MOUSE Probable E3 ubiquitin-protein ligase HECTD2 OS=Mus musculus GN=Hectd2 PE=1 SV=2 472 838 4.0E-60
sp|Q5RD78|HECD2_PONAB Probable E3 ubiquitin-protein ligase HECTD2 OS=Pongo abelii GN=HECTD2 PE=2 SV=1 472 838 1.0E-58
sp|Q5U5R9|HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens GN=HECTD2 PE=2 SV=2 472 838 1.0E-58
sp|O08759|UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus GN=Ube3a PE=1 SV=2 485 836 3.0E-54
sp|Q05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens GN=UBE3A PE=1 SV=4 485 836 7.0E-54
sp|Q8RWB8|UPL6_ARATH E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1 485 835 5.0E-53
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 486 835 3.0E-50
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 486 835 3.0E-50
sp|Q9SCQ2|UPL7_ARATH E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1 485 835 1.0E-48
sp|O15033|AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens GN=AREL1 PE=1 SV=3 464 836 2.0E-48
sp|Q8CHG5|AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus GN=Arel1 PE=2 SV=2 464 836 3.0E-48
sp|Q15386|UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3 466 835 7.0E-47
sp|Q80U95|UBE3C_MOUSE Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=1 SV=2 466 835 2.0E-46
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 485 837 5.0E-45
sp|Q9ES34|UBE3B_MOUSE Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=1 SV=3 479 835 9.0E-45
sp|Q7Z3V4|UBE3B_HUMAN Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=3 479 835 2.0E-44
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 486 835 5.0E-44
sp|Q08CZ0|UBE3B_XENTR Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1 479 835 5.0E-44
sp|Q757T0|HUL4_ASHGO Probable E3 ubiquitin-protein ligase HUL4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUL4 PE=3 SV=1 485 836 6.0E-44
sp|P40985|HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL4 PE=1 SV=2 485 836 8.0E-44
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 486 835 5.0E-43
sp|O94275|MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug30 PE=1 SV=1 486 836 3.0E-42
sp|Q1K9C4|YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.07c PE=2 SV=1 488 836 2.0E-41
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 493 829 1.0E-35
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 486 836 1.0E-34
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 434 835 1.0E-33
sp|P53119|HUL5_YEAST Probable E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL5 PE=1 SV=1 476 835 2.0E-31
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 486 835 5.0E-29
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 493 829 4.0E-28
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 515 829 4.0E-27
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 11 298 3.0E-26
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 11 298 4.0E-26
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 11 305 6.0E-26
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 11 341 1.0E-25
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 11 305 2.0E-25
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 11 298 3.0E-25
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 499 831 2.0E-24
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 574 831 3.0E-24
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 574 831 3.0E-24
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 488 831 6.0E-24
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 574 831 8.0E-24
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 574 831 1.0E-23
sp|P51592|HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster GN=hyd PE=1 SV=3 569 835 2.0E-23
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 485 834 2.0E-21
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 515 830 2.0E-20
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 490 834 4.0E-20
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 574 836 4.0E-20
sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 562 836 5.0E-20
sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 562 836 5.0E-20
sp|Q62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus GN=Ubr5 PE=1 SV=3 562 836 6.0E-20
sp|Q3U487|HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus GN=Hectd3 PE=1 SV=2 515 835 1.0E-19
sp|Q1L8J7|YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio GN=yap1 PE=2 SV=2 361 512 2.0E-19
sp|Q5T447|HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens GN=HECTD3 PE=1 SV=1 515 835 5.0E-19
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 361 449 5.0E-18
sp|P46938|YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus GN=Yap1 PE=1 SV=2 361 449 1.0E-17
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 560 834 3.0E-17
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 1 132 4.0E-17
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 407 834 9.0E-17
sp|D6C652|YAP1A_XENLA Transcriptional coactivator YAP1-A OS=Xenopus laevis GN=yap1-a PE=1 SV=1 341 449 5.0E-16
sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens GN=YAP1 PE=1 SV=2 361 449 8.0E-15
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 265 447 6.0E-14
sp|A4IIJ3|KIBRA_XENTR Protein KIBRA OS=Xenopus tropicalis GN=wwc1 PE=2 SV=1 361 498 6.0E-14
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 646 835 6.0E-14
sp|Q45VV3|YAP1_DROME Transcriptional coactivator yorkie OS=Drosophila melanogaster GN=yki PE=1 SV=2 359 453 1.0E-13
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 361 449 1.0E-13
sp|Q8IX03|KIBRA_HUMAN Protein KIBRA OS=Homo sapiens GN=WWC1 PE=1 SV=1 361 501 2.0E-13
sp|Q5SXA9|KIBRA_MOUSE Protein KIBRA OS=Mus musculus GN=Wwc1 PE=1 SV=1 361 501 3.0E-13
sp|Q1L8J7|YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio GN=yap1 PE=2 SV=2 187 411 1.0E-12
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 646 835 1.0E-12
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 261 419 2.0E-12
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 239 391 3.0E-12
sp|Q6AWC2|WWC2_HUMAN Protein WWC2 OS=Homo sapiens GN=WWC2 PE=1 SV=2 356 501 6.0E-12
sp|P46938|YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus GN=Yap1 PE=1 SV=2 239 391 1.0E-11
sp|Q6NXJ0|WWC2_MOUSE Protein WWC2 OS=Mus musculus GN=Wwc2 PE=1 SV=1 356 501 2.0E-11
sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens GN=YAP1 PE=1 SV=2 187 391 3.0E-11
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 350 456 7.0E-11
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 350 456 9.0E-11
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 350 456 9.0E-11
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 350 456 2.0E-10
sp|Q6DJR2|WWC2_XENTR Protein WWC2 OS=Xenopus tropicalis GN=wwc2 PE=2 SV=1 357 448 7.0E-10
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 359 449 1.0E-09
sp|Q45VV3|YAP1_DROME Transcriptional coactivator yorkie OS=Drosophila melanogaster GN=yki PE=1 SV=2 258 399 2.0E-09
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 359 449 2.0E-09
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 210 336 3.0E-09
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 359 449 3.0E-09
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 361 449 5.0E-09
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 265 340 9.0E-09
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 265 340 1.0E-08
sp|O88382|MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Magi2 PE=1 SV=1 361 479 1.0E-08
sp|Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus GN=Magi2 PE=1 SV=2 361 449 2.0E-08
sp|Q86UL8|MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens GN=MAGI2 PE=1 SV=3 361 479 2.0E-08
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 361 449 3.0E-08
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 361 447 4.0E-08
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 361 447 5.0E-08
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 350 462 8.0E-08
sp|Q19404|YAP1_CAEEL Yes-associated protein homolog 1 OS=Caenorhabditis elegans GN=yap-1 PE=1 SV=2 409 449 1.0E-07
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 415 449 2.0E-07
sp|Q9FIK8|CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11 OS=Arabidopsis thaliana GN=CAR11 PE=1 SV=1 12 87 2.0E-07
sp|B4K6I9|KIBRA_DROMO Protein kibra OS=Drosophila mojavensis GN=Kibra PE=3 SV=1 361 448 2.0E-07
sp|Q5TCQ9|MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens GN=MAGI3 PE=1 SV=2 415 449 2.0E-07
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 415 449 3.0E-07
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 415 449 3.0E-07
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 415 449 3.0E-07
sp|B3LWS4|KIBRA_DROAN Protein kibra OS=Drosophila ananassae GN=Kibra PE=3 SV=1 361 448 3.0E-07
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 415 449 4.0E-07
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 201 294 5.0E-07
sp|B4M5X4|KIBRA_DROVI Protein kibra OS=Drosophila virilis GN=Kibra PE=3 SV=1 361 448 6.0E-07
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 211 336 7.0E-07
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 415 449 8.0E-07
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 12 100 1.0E-06
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 262 356 1.0E-06
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 415 449 1.0E-06
sp|O88382|MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Magi2 PE=1 SV=1 406 449 1.0E-06
sp|B4PSQ2|KIBRA_DROYA Protein kibra OS=Drosophila yakuba GN=Kibra PE=3 SV=1 361 448 1.0E-06
sp|B4HEJ6|KIBRA_DROSE Protein kibra OS=Drosophila sechellia GN=Kibra PE=3 SV=1 361 448 1.0E-06
sp|B3P3M8|KIBRA_DROER Protein kibra OS=Drosophila erecta GN=Kibra PE=3 SV=1 361 448 1.0E-06
sp|Q9VFG8|KIBRA_DROME Protein kibra OS=Drosophila melanogaster GN=kibra PE=1 SV=2 361 448 1.0E-06
sp|Q8VEB2|SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus GN=Sav1 PE=1 SV=2 346 460 1.0E-06
sp|A4V8B4|SAV1_RAT Protein salvador homolog 1 OS=Rattus norvegicus GN=Sav1 PE=2 SV=1 346 460 1.0E-06
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 12 100 2.0E-06
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 12 100 2.0E-06
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 12 100 2.0E-06
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 12 95 2.0E-06
sp|Q86UL8|MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens GN=MAGI2 PE=1 SV=3 408 449 2.0E-06
sp|B4NAD3|KIBRA_DROWI Protein kibra OS=Drosophila willistoni GN=Kibra PE=3 SV=1 361 448 2.0E-06
sp|C6KTB7|ALTH1_PLAF7 Putative E3 ubiquitin-protein ligase protein PFF1365c OS=Plasmodium falciparum (isolate 3D7) GN=PFF1365c PE=3 SV=1 571 830 2.0E-06
sp|Q9H4B6|SAV1_HUMAN Protein salvador homolog 1 OS=Homo sapiens GN=SAV1 PE=1 SV=2 349 460 2.0E-06
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 11 136 2.0E-06
sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 11 136 2.0E-06
sp|Q9UPW8|UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens GN=UNC13A PE=2 SV=4 11 136 2.0E-06
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 12 132 2.0E-06
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 12 95 3.0E-06
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 260 317 3.0E-06
sp|Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus GN=Magi2 PE=1 SV=2 417 449 3.0E-06
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 417 458 4.0E-06
sp|P46938|YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus GN=Yap1 PE=1 SV=2 417 458 4.0E-06
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 12 118 4.0E-06
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 396 496 7.0E-06
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 12 120 7.0E-06
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 237 291 8.0E-06
sp|Q5TCQ9|MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens GN=MAGI3 PE=1 SV=2 361 436 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|061100
MSVPPRPIDKKIRVTVVAADGLSKRDVFRLPDPFAVVTVDAEQTHTTSVIKKTLNPYWNESFDITVKESSVIAVQ
IFDQRKFKRRDQGFLGVVNVRVADVLDLELDSHQMMTLDLKKSNDNLVVHGKLVVYLSTNINQPITNPGPGTTAG
VTTGMADLSIETGSTAGSSSTVGLQAGANGGGLSRTPSSHATEASAATATASPDTDHPQPDAVSRPSSTPPSNPP
TNPPSISQQSPQPAPPSTPPAQNGRNFDPSVDQYGPLPAGWERRIDPLGRTYYVDHNTRTTTWNRPSASAAVNTS
AQDNETNAARDQHSRRILVDDVLEATSPSNRAEAPPPAATPPSGPTQMSAGSATTAGTGSLPNGWEERYTPEGRP
YYVDHNTRTTTWVDPRRQTIIRVMGPNGQGSVQPQTISQLGPLPSGWEMRLTSTARVYFVDHNTKTTTWDDPRLP
STLDSNVPQYKRDFRRKLIYFRSQPAMRAQPGNCQIKVRRNHIFEDSYAEIMRQTPNDLKKRLMIKFDGEDGLDY
GGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPASGVNPEHLNYFKFIGRCLGLGIFHRRFLDAYFIVSFY
KMILKKKVTLADLESVDTELHRGLTWMLDNDITDVIDETFTTTEDRFGEMVTVELKPGGEEVPVTEENKKEYVEL
VVEYRIVRRVKEQFDAFMSGFSELIPLELVTVFDERELELLIGGMSEIDVDDWTKYTDYRGYEQSDEVIQWFWKC
VRSWPPERKSRLLQFATGTSRIPVNGFKDLQGSDGPRRFTIEKSGDPSQLPKSHTCFNRIDLPPYKDYASLEYKL
TLAVEETVGFGQE*
Coding >Agabi119p4|061100
ATGTCTGTTCCTCCTCGTCCAATAGACAAGAAAATCCGTGTAACAGTCGTCGCCGCGGATGGCCTTTCAAAGCGC
GATGTGTTTAGACTGCCTGATCCGTTTGCTGTCGTCACTGTAGACGCAGAACAAACTCATACGACCAGTGTAATC
AAGAAGACCCTCAATCCATACTGGAATGAATCATTCGACATAACGGTGAAAGAATCGTCAGTGATTGCGGTCCAA
ATCTTTGACCAACGCAAGTTCAAGCGACGGGATCAAGGTTTTCTGGGAGTGGTGAATGTCAGAGTTGCTGATGTG
CTCGACTTGGAGCTGGACAGTCATCAGATGATGACATTGGACCTCAAGAAGTCCAACGACAATCTTGTTGTGCAT
GGCAAGTTGGTGGTGTACCTCTCCACAAACATTAATCAGCCCATTACGAATCCGGGCCCAGGGACGACTGCGGGC
GTCACGACTGGGATGGCGGACCTGAGTATAGAGACTGGGTCGACGGCTGGGAGCTCTTCGACCGTTGGGCTGCAG
GCCGGAGCGAACGGCGGCGGGCTCTCGCGGACGCCGAGCTCCCACGCTACGGAGGCTTCGGCGGCAACAGCAACG
GCATCTCCGGACACGGATCACCCGCAGCCGGATGCCGTCTCTCGCCCCTCCTCCACTCCTCCTTCAAATCCCCCC
ACAAATCCTCCCTCCATTTCTCAGCAGTCCCCTCAGCCCGCACCACCCTCCACCCCTCCCGCCCAGAACGGGCGC
AACTTTGACCCCAGCGTCGACCAGTACGGCCCGCTGCCTGCTGGGTGGGAACGCCGGATTGATCCCCTCGGCCGC
ACCTATTATGTCGACCACAACACTCGTACTACAACCTGGAACCGTCCCTCTGCCAGCGCAGCTGTCAACACCTCT
GCGCAAGACAATGAAACAAACGCTGCCCGCGATCAGCACTCTCGCCGCATTCTCGTTGACGATGTGTTGGAGGCA
ACCAGTCCATCAAATCGCGCAGAAGCACCGCCACCAGCAGCTACCCCTCCAAGCGGCCCCACACAGATGTCTGCT
GGAAGTGCTACAACCGCTGGTACAGGATCTCTTCCCAATGGGTGGGAGGAACGCTACACTCCTGAAGGTCGTCCC
TACTACGTCGATCACAATACAAGGACAACAACCTGGGTTGATCCTCGCCGACAAACCATCATTCGGGTGATGGGC
CCGAATGGACAGGGATCGGTACAACCCCAAACTATTTCGCAATTAGGTCCTTTGCCTTCCGGATGGGAAATGCGT
CTCACATCTACTGCTCGAGTCTACTTTGTCGACCACAATACCAAGACTACTACATGGGACGATCCTCGCCTGCCC
TCGACTCTCGACTCCAACGTTCCTCAGTATAAACGAGACTTTAGGCGCAAGCTCATTTACTTCAGAAGTCAACCC
GCAATGCGTGCGCAGCCTGGTAATTGCCAGATCAAAGTCAGGCGGAACCACATTTTCGAGGATAGTTACGCAGAA
ATCATGCGGCAGACACCGAACGATTTGAAAAAGCGCCTGATGATTAAGTTTGACGGCGAAGACGGTTTGGATTAC
GGTGGTCTGTCAAGGGAGTTCTTCTTCCTCCTCTCACATGAAATGTTCAACCCCTTCTACTGTCTATTTGAGTAC
TCCGCGCACGATAATTATACCCTTCAGATTAACCCAGCATCCGGTGTCAACCCCGAGCATTTGAATTACTTCAAA
TTCATCGGTAGATGTCTGGGCCTAGGTATCTTTCACCGACGTTTCCTCGATGCCTACTTTATCGTCAGCTTCTAC
AAAATGATTCTGAAAAAGAAAGTAACGCTTGCGGATTTGGAAAGTGTTGACACGGAGTTGCACCGAGGTTTGACA
TGGATGCTAGATAATGATATCACGGACGTCATTGATGAGACATTCACGACAACAGAGGATCGCTTCGGCGAAATG
GTGACGGTGGAACTCAAGCCGGGAGGAGAAGAGGTCCCTGTAACAGAGGAGAACAAGAAGGAATACGTCGAACTT
GTGGTCGAGTATCGTATCGTGAGGCGTGTCAAGGAGCAGTTTGACGCATTCATGTCCGGTTTCAGTGAACTCATT
CCCCTGGAGCTGGTCACCGTGTTCGACGAGCGGGAATTAGAACTTCTCATTGGTGGTATGTCAGAAATTGACGTC
GATGACTGGACTAAATATACCGATTATCGCGGTTATGAACAATCTGATGAGGTCATCCAATGGTTCTGGAAATGT
GTTCGTTCTTGGCCTCCGGAACGGAAATCCCGTCTGCTCCAATTCGCTACGGGTACTTCTCGAATACCCGTCAAT
GGATTCAAAGACTTGCAAGGTTCAGATGGGCCTCGACGGTTTACCATCGAAAAGTCTGGCGATCCTTCGCAGCTG
CCAAAGAGTCATACATGCTTCAACAGAATTGATTTACCACCATATAAGGATTATGCGAGTCTCGAATATAAATTG
ACTTTGGCAGTGGAGGAAACTGTCGGATTCGGTCAAGAGTAG
Transcript >Agabi119p4|061100
ATGTCTGTTCCTCCTCGTCCAATAGACAAGAAAATCCGTGTAACAGTCGTCGCCGCGGATGGCCTTTCAAAGCGC
GATGTGTTTAGACTGCCTGATCCGTTTGCTGTCGTCACTGTAGACGCAGAACAAACTCATACGACCAGTGTAATC
AAGAAGACCCTCAATCCATACTGGAATGAATCATTCGACATAACGGTGAAAGAATCGTCAGTGATTGCGGTCCAA
ATCTTTGACCAACGCAAGTTCAAGCGACGGGATCAAGGTTTTCTGGGAGTGGTGAATGTCAGAGTTGCTGATGTG
CTCGACTTGGAGCTGGACAGTCATCAGATGATGACATTGGACCTCAAGAAGTCCAACGACAATCTTGTTGTGCAT
GGCAAGTTGGTGGTGTACCTCTCCACAAACATTAATCAGCCCATTACGAATCCGGGCCCAGGGACGACTGCGGGC
GTCACGACTGGGATGGCGGACCTGAGTATAGAGACTGGGTCGACGGCTGGGAGCTCTTCGACCGTTGGGCTGCAG
GCCGGAGCGAACGGCGGCGGGCTCTCGCGGACGCCGAGCTCCCACGCTACGGAGGCTTCGGCGGCAACAGCAACG
GCATCTCCGGACACGGATCACCCGCAGCCGGATGCCGTCTCTCGCCCCTCCTCCACTCCTCCTTCAAATCCCCCC
ACAAATCCTCCCTCCATTTCTCAGCAGTCCCCTCAGCCCGCACCACCCTCCACCCCTCCCGCCCAGAACGGGCGC
AACTTTGACCCCAGCGTCGACCAGTACGGCCCGCTGCCTGCTGGGTGGGAACGCCGGATTGATCCCCTCGGCCGC
ACCTATTATGTCGACCACAACACTCGTACTACAACCTGGAACCGTCCCTCTGCCAGCGCAGCTGTCAACACCTCT
GCGCAAGACAATGAAACAAACGCTGCCCGCGATCAGCACTCTCGCCGCATTCTCGTTGACGATGTGTTGGAGGCA
ACCAGTCCATCAAATCGCGCAGAAGCACCGCCACCAGCAGCTACCCCTCCAAGCGGCCCCACACAGATGTCTGCT
GGAAGTGCTACAACCGCTGGTACAGGATCTCTTCCCAATGGGTGGGAGGAACGCTACACTCCTGAAGGTCGTCCC
TACTACGTCGATCACAATACAAGGACAACAACCTGGGTTGATCCTCGCCGACAAACCATCATTCGGGTGATGGGC
CCGAATGGACAGGGATCGGTACAACCCCAAACTATTTCGCAATTAGGTCCTTTGCCTTCCGGATGGGAAATGCGT
CTCACATCTACTGCTCGAGTCTACTTTGTCGACCACAATACCAAGACTACTACATGGGACGATCCTCGCCTGCCC
TCGACTCTCGACTCCAACGTTCCTCAGTATAAACGAGACTTTAGGCGCAAGCTCATTTACTTCAGAAGTCAACCC
GCAATGCGTGCGCAGCCTGGTAATTGCCAGATCAAAGTCAGGCGGAACCACATTTTCGAGGATAGTTACGCAGAA
ATCATGCGGCAGACACCGAACGATTTGAAAAAGCGCCTGATGATTAAGTTTGACGGCGAAGACGGTTTGGATTAC
GGTGGTCTGTCAAGGGAGTTCTTCTTCCTCCTCTCACATGAAATGTTCAACCCCTTCTACTGTCTATTTGAGTAC
TCCGCGCACGATAATTATACCCTTCAGATTAACCCAGCATCCGGTGTCAACCCCGAGCATTTGAATTACTTCAAA
TTCATCGGTAGATGTCTGGGCCTAGGTATCTTTCACCGACGTTTCCTCGATGCCTACTTTATCGTCAGCTTCTAC
AAAATGATTCTGAAAAAGAAAGTAACGCTTGCGGATTTGGAAAGTGTTGACACGGAGTTGCACCGAGGTTTGACA
TGGATGCTAGATAATGATATCACGGACGTCATTGATGAGACATTCACGACAACAGAGGATCGCTTCGGCGAAATG
GTGACGGTGGAACTCAAGCCGGGAGGAGAAGAGGTCCCTGTAACAGAGGAGAACAAGAAGGAATACGTCGAACTT
GTGGTCGAGTATCGTATCGTGAGGCGTGTCAAGGAGCAGTTTGACGCATTCATGTCCGGTTTCAGTGAACTCATT
CCCCTGGAGCTGGTCACCGTGTTCGACGAGCGGGAATTAGAACTTCTCATTGGTGGTATGTCAGAAATTGACGTC
GATGACTGGACTAAATATACCGATTATCGCGGTTATGAACAATCTGATGAGGTCATCCAATGGTTCTGGAAATGT
GTTCGTTCTTGGCCTCCGGAACGGAAATCCCGTCTGCTCCAATTCGCTACGGGTACTTCTCGAATACCCGTCAAT
GGATTCAAAGACTTGCAAGGTTCAGATGGGCCTCGACGGTTTACCATCGAAAAGTCTGGCGATCCTTCGCAGCTG
CCAAAGAGTCATACATGCTTCAACAGAATTGATTTACCACCATATAAGGATTATGCGAGTCTCGAATATAAATTG
ACTTTGGCAGTGGAGGAAACTGTCGGATTCGGTCAAGAGTAG
Gene >Agabi119p4|061100
ATGTCTGTTCCTCCTCGTCCAATGTGAGCCTTTTTCTCAGCTGGCCACCTGTGCATATGTCTTACTTGGGTTTCG
TGCAGAGACAAGAAAATCCGTGTAACAGGTCGGCTGTCTACCTTGGATATCTACATCATGGCTAATTCTTCTATC
ACTGACAGTCGTCGCCGCGGATGGCCTTTCAAAGCGCGATGTGTTTAGACTGCCTGATCCGTTTGCTGTCGTCAC
TGTAGACGCAGAACAAACTCATACGACCAGTGTAATCAAGAAGACCCTCAATCCATACTGGAATGAATCATTCGA
CATGTAGGCTACATACTTTCTCACCGCTTCACCGGCCTTCTCATGTGAAATCGCAGAACGGTGAAAGAATCGTCA
GTGATTGCGGTCCAAATCTTTGACCAACGCAAGTTCAAGCGACGGGATCAAGGTTTTCTGGGAGTGGTGAATGTC
AGAGTTGCTGATGTGCTCGACTTGGAGCTGGACAGTCATCGTGCGTATGCTCCTGTTTCACTCTGCATACAGATA
TAGTAACGCCATTTTTTCTTTGTAGAGATGATGACATTGGACCTCAAGAAGTCCAACGACAATCTTGTTGTGCAT
GGCAAGTTGGTGGTGTACCTCTCCACAAACATTAATCAGCCCATTACGAATCCGGGCCCAGGGACGACTGCGGGC
GTCACGACTGGGATGGCGGACCTGAGTATAGAGACTGGGTCGACGGCTGGGAGCTCTTCGACCGTTGGGCTGCAG
GCCGGAGCGAACGGCGGCGGGCTCTCGCGGACGCCGAGCTCCCACGCTACGGAGGCTTCGGCGGCAACAGCAACG
GCATCTCCGGACACGGATCACCCGCAGCCGGATGCCGTCTCTCGCCCCTCCTCCACTCCTCCTTCAAATCCCCCC
ACAAATCCTCCCTCCATTTCTCAGCAGTCCCCTCAGCCCGCACCACCCTCCACCCCTCCCGCCCAGAACGGGCGC
AACTTTGACCCCAGCGTCGACCAGTACGGCCCGCTGCCTGCTGGGTGGGAACGCCGGATTGATCCCCTCGGCCGC
ACCTATTATGTCGACCACAACACTCGTACTACAACCTGGAACCGTCCCTCTGCCAGCGCAGCTGTCAACACCTCT
GCGCAAGACAATGAAACAAACGCTGCCCGCGATCAGCACTCTCGCCGCATTCTCGTTGACGATGTGTTGGAGGCA
ACCAGTCCATCAAATCGCGCAGAAGCACCGCCACCAGCAGCTACCCCTCCAAGCGGCCCCACACAGATGTCTGCT
GGAAGTGCTACAACCGCTGGTACAGGATCTCTTCCCAATGGGTGGGAGGAACGCTACACTCCTGAAGGTCGTCCC
TACTACGTCGATCACAATACAAGGACAACAACCTGGGTTGATCCTCGCCGACAAACCATCATTCGGGTGATGGGC
CCGAATGGACAGGGATCGGTACAACCCCAAACTATTTCGCAATTAGGTCCTTTGCCTTCCGGATGGGAAATGCGT
CTCACATCTACTGCTCGAGTCTACTTTGTCGACCACAATACCAAGACTACTACATGGGACGATCCTCGCCTGCCC
TCGACTCTCGACTCCAACGTTCCTCAGTATAAACGAGACTTTAGGCGCAAGCTCATTTACTTCAGAAGTCAACCC
GCAATGCGTGCGCAGCCTGGTAATTGCCAGATCAAAGTCAGGCGGAACCACATTTTCGAGGATAGTTACGCAGAA
ATCATGCGGCAGACACCGAACGATTTGAAAAAGCGCCTGATGATTAAGTTTGACGGCGAAGACGGTTTGGATTAC
GGTGGTCTGTCAAGGTATTTCACCTTTGAAGCTTTATGCCGCGATAGTGGGCTCACAAATCTCAAATAGGGAGTT
CTTCTTCCTCCTCTCACATGAAATGTTCAACCCCTTCTACTGTCTATTTGAGTACTCCGCGCACGATAATTATAC
CCTTCAGATTAACCCAGCATCCGGTGTCAACCCCGAGCATTTGAATTACTTCAAATTCATCGGTAGATGTCTGGG
CCTAGGTATCTTTCACCGACGTTTCCTCGATGCCTACTTTATCGTCAGCTTCTACAAAATGATTCTGAAAAAGAA
AGTAACGCTTGCGGATTTGGAAAGTGTTGACACGGAGTTGCACCGAGGTTTGACATGGATGCTGTAGGTTTCATA
ATCACTCAGGTCGACATAGATCACTGACGTATACACATGAACAGAGATAATGATATCACGGACGTCATTGATGAG
ACATTCACGACAACAGAGGATCGCTTCGGCGAAATGGTGACGGTGGAACTCAAGCCGGGAGGAGAAGAGGTCCCT
GTAACAGAGGAGAACAAGAAGGAATACGTCGAACTTGTGGTCGAGTATCGTATCGTGAGGCGTGTCAAGGAGCAG
TTTGACGCATTCATGTCCGGTTTCAGTGAACTCATTCCCCTGGAGCTGGTCACCGTGTTCGACGAGCGGGAATTA
GAACTTCTCATTGGTGGTATGTCAGAAATTGACGTGTACGTTTTATCTTCGCTTCGCAAGGTTATCTTTCCATCG
CTAACAACCATTTAGCGATGACTGGACTAAATATACCGATTATCGCGGTTATGAACAATCTGATGAGGTCATCCA
ATGGTTCTGGAAATGTGTTCGTTCTTGGCCTCCGGAACGGAAATCCCGTCTGCTCCAATTCGCTACGGGTACTTC
TCGAATACCCGTCAATGGATTCAAAGACTTGCAAGGTTCAGATGGGCCTCGACGGTTTACCATCGAAAAGTCTGG
CGATCCTTCGCAGCTGCCAAAGAGTCATACATGCTTCAACAGAATTGATTTACCACCATATAAGGATTATGCGAG
TCTCGAATATAAATTGACTTTGGCAGTGGAGTGAGTTATTTTTTCAATTCTTGCAATCTTTCAAGCATGATACTG
ACCTGATGTGTAGGGAAACTGTCGGATTCGGTCAAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail