Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|060760
Gene name
Locationscaffold_03b:78797..84256
Strand+
Gene length (bp)5459
Transcript length (bp)3978
Coding sequence length (bp)3978
Protein length (aa) 1326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02538 Hydantoinase_B Hydantoinase B/oxoprolinase 2.9E-112 704 1139
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 1.1E-81 214 500
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 3.1E-46 10 193
PF19278 Hydant_A_C Hydantoinase/oxoprolinase C-terminal domain 2.1E-06 519 681

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14841|OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens GN=OPLAH PE=1 SV=3 6 1210 3.0E-98
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 11 687 1.0E-97
sp|Q58374|Y964_METJA Uncharacterized protein MJ0964 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0964 PE=3 SV=1 9 687 7.0E-94
sp|Q9FIZ7|OPLA_ARATH 5-oxoprolinase OS=Arabidopsis thaliana GN=OXP1 PE=2 SV=1 6 1212 2.0E-93
sp|P97608|OPLA_RAT 5-oxoprolinase OS=Rattus norvegicus GN=Oplah PE=1 SV=2 6 1210 1.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14841|OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens GN=OPLAH PE=1 SV=3 6 1210 3.0E-98
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 11 687 1.0E-97
sp|Q58374|Y964_METJA Uncharacterized protein MJ0964 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0964 PE=3 SV=1 9 687 7.0E-94
sp|Q9FIZ7|OPLA_ARATH 5-oxoprolinase OS=Arabidopsis thaliana GN=OXP1 PE=2 SV=1 6 1212 2.0E-93
sp|P97608|OPLA_RAT 5-oxoprolinase OS=Rattus norvegicus GN=Oplah PE=1 SV=2 6 1210 1.0E-91
sp|Q10093|YAOE_SCHPO Uncharacterized protein C11D3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.14c PE=3 SV=1 10 1209 2.0E-91
sp|Q75WB5|OPLA_BOVIN 5-oxoprolinase OS=Bos taurus GN=OPLAH PE=1 SV=1 6 1055 5.0E-90
sp|Q8K010|OPLA_MOUSE 5-oxoprolinase OS=Mus musculus GN=Oplah PE=1 SV=1 9 1210 8.0E-89
sp|Q10094|YAOF_SCHPO Uncharacterized protein C11D3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.15 PE=3 SV=1 10 1139 9.0E-86
sp|Q54NW6|OPLA_DICDI 5-oxoprolinase OS=Dictyostelium discoideum GN=oplah PE=3 SV=2 10 1055 3.0E-84
sp|P28273|OPLA_YEAST 5-oxoprolinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXP1 PE=1 SV=2 6 1146 3.0E-78
sp|Q5P5G4|APCC_AROAE Acetophenone carboxylase gamma subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc3 PE=1 SV=1 3 680 8.0E-73
sp|Q8RM04|ACXA_XANP2 Acetone carboxylase beta subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acxA PE=1 SV=1 6 676 2.0E-46
sp|Q5P5G2|APCA_AROAE Acetophenone carboxylase alpha subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc1 PE=1 SV=1 8 499 9.0E-43
sp|Q01263|HYUB_PSESN Hydantoin utilization protein B OS=Pseudomonas sp. (strain NS671) GN=hyuB PE=3 SV=1 703 1253 2.0E-42
sp|Q58373|Y963_METJA Uncharacterized protein MJ0963 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0963 PE=3 SV=1 703 1253 2.0E-39
sp|Q5P5G5|APCD_AROAE Acetophenone carboxylase delta subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc4 PE=1 SV=1 754 1253 3.0E-20
sp|Q8RM03|ACXB_XANP2 Acetone carboxylase alpha subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acxB PE=1 SV=1 690 1030 9.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|060760
MRMTDQGVWKLGIDVGGTFTDAVLYHESTGEIYKAKVPSTPQDQSEGVLSAIASLRSQVPDGENIKIASLNHGTT
VATNAVLEGKGASVALLVTEGYKDILQIRRSHVPGGLAGWITWSKPEPLAPLELTIEVPGRISSSGEVVRPFDAE
LLRTRLQKLKNSKTRPESITISLINSFANPTHERQVAQLVRTEFPGIPLSLSSDVLPEIMEYERTVTTVANAYVK
PVVHRYLANLETALKDIPVNVLRSDGGLSGASIAKEHCATLLYSGPAGGVTGVINQVARRTKYKNLMSFDMGGTS
TDVCLIENGKADLRRESTIGDLTIRAPSIDVRTVGAGGGSIASVAEITGALRVGPESAGAIPGPACYSKGGNKAT
VTDALAVLGYLPPALLGGSFHLDVNAAFKVIEENIVKPMKLATAVEAAEGIIRIALEKVHGSLRSVSVEKGKDPR
DYNLVSFGGAGGLVACELAKICGVAYPLIIPPSPGVLCALGEAYTGIRHEVSTTMIHKLKDMNVSDFQGACDNLK
TRVSSVLLEQKIMDFAIGFEVDLRFHGQATNLPVSFEQQEVIDHGFIILEDRFKENHVSLFTFALDLDVEMVNLR
TFAQEKTREIKTQPLEQGDNPEVENTLQLTSLYYGGRKYDEVPIIDRDRLRSGNVLKGPCVIYETDSTTFLAPGH
RAEIDHVANILIWPDISERIPLGVSSTFNPIVVQLVEAVLQNVRTEMDTLIMRVAMSPAMREQLDYFPMIAAGDG
PHSGKMVCGQFGSFIPGFLASWEESIEEGDIFLTNDPYSCSNAISHLNDFLVINPVHYRGKLVAWIANIGHFTDI
GSSVPGSMPSHARTIHEDGIQIPLCKLYSRNTLNTAVFKIIERNSRKPDFTRSDLIALVAATKIAARRIKEMCER
FGTDAYEHALDILLTRNKLAVGKIIKTTLSSEKVHFEDYIDDDGHGTGPWRIACTMWKEVNGEGDHVVVLDFDGT
DPQSDKSVNFALSHEMLKMFVVYYLLTVFDPTTIVNDGSFELIQIKVPEGTLLNPVWPAALSGRTPLIGRLFDVL
GAIFGQRTPEFLSAAGYSDSPHFFFSGWNRMGEWFQLYQIGFGGIPGRPHGDGPDGHSMWPSMRSVPNEFLESYL
PLRVDKYQTVPDSGEKACIVGVTPCALIMCSSIREMFRSRKTLVRYSVNQDSPPREIIESKKDFLEVSAGDVLEW
VTWGGGGYGDALQRDPHLVAKEVQRGLVADATRYGVCLDAAGDVDLEATKSLRLEMKPQQDLLSKEIFNRGGSMK
ELRDRCLEETGLPPPFLPSGRNLRGPITQIPHLRELQERRKREDALLYQA*
Coding >Agabi119p4|060760
ATGCGAATGACAGATCAAGGTGTTTGGAAACTGGGTATAGATGTTGGTGGAACGTTTACAGATGCAGTGTTATAC
CATGAAAGCACCGGTGAAATATACAAGGCCAAGGTCCCCAGCACACCCCAAGATCAGAGCGAAGGCGTTCTGAGT
GCTATCGCCTCCCTGCGATCACAAGTACCAGACGGAGAAAACATAAAGATAGCCAGCCTCAATCACGGAACGACT
GTCGCAACCAATGCTGTTCTAGAAGGCAAAGGTGCCAGTGTTGCTTTGTTGGTCACTGAAGGATACAAAGATATC
CTTCAAATACGACGTTCTCATGTGCCCGGAGGACTGGCAGGATGGATCACTTGGTCAAAGCCGGAACCTCTTGCT
CCTCTGGAACTTACTATTGAAGTCCCTGGCCGTATTTCTTCATCGGGAGAAGTCGTTCGCCCCTTCGACGCAGAA
CTTCTCCGGACTCGACTTCAAAAACTCAAGAATTCCAAAACAAGACCAGAATCTATTACGATCTCGCTCATCAAC
TCGTTCGCCAATCCCACACATGAACGTCAAGTTGCCCAACTTGTTCGGACTGAGTTTCCTGGTATACCTCTTTCC
CTCAGCAGTGATGTCTTGCCGGAAATCATGGAATATGAAAGAACAGTGACTACGGTTGCGAATGCCTATGTGAAA
CCCGTCGTTCATCGCTATTTGGCTAATCTCGAGACTGCGTTGAAAGATATACCAGTTAATGTTTTGCGAAGCGAC
GGTGGTCTTTCCGGTGCTAGTATTGCAAAGGAACACTGTGCAACTCTTTTGTACTCGGGACCCGCGGGAGGAGTT
ACTGGTGTAATCAACCAAGTTGCCAGAAGAACAAAATACAAGAATTTGATGTCGTTTGACATGGGAGGTACAAGC
ACCGATGTATGTCTTATTGAAAATGGCAAAGCAGATTTACGTCGGGAAAGTACTATCGGTGATCTGACCATACGC
GCTCCTTCGATCGACGTCCGCACTGTAGGCGCGGGTGGAGGGTCTATCGCTTCTGTTGCCGAAATAACTGGAGCC
CTGCGCGTCGGGCCAGAAAGTGCTGGTGCGATCCCAGGACCCGCATGCTACAGCAAAGGTGGCAATAAAGCCACA
GTCACCGACGCCTTGGCCGTTCTTGGATACTTACCCCCAGCTTTACTCGGAGGTTCCTTCCATCTCGATGTCAAT
GCCGCTTTTAAAGTCATAGAAGAAAACATTGTAAAGCCAATGAAACTTGCTACTGCCGTTGAAGCTGCGGAAGGT
ATCATCCGTATTGCACTCGAGAAAGTTCACGGGAGTTTGCGAAGTGTCAGTGTAGAAAAGGGGAAAGACCCTAGA
GACTATAATCTCGTTAGTTTTGGTGGTGCTGGTGGTTTGGTCGCTTGTGAACTGGCCAAAATATGCGGTGTCGCA
TATCCTCTTATTATTCCTCCATCACCGGGTGTTCTGTGTGCTCTTGGCGAGGCTTATACCGGCATCAGACATGAA
GTTTCGACGACAATGATTCACAAGCTGAAGGACATGAATGTATCGGATTTCCAGGGGGCATGCGATAACCTCAAA
ACCCGAGTCTCCTCGGTACTACTTGAACAAAAAATCATGGACTTTGCGATTGGTTTCGAAGTCGATCTCCGTTTC
CACGGACAAGCCACTAATCTTCCAGTGTCATTTGAACAACAAGAAGTCATTGACCATGGTTTCATTATTCTCGAG
GATCGTTTCAAAGAAAACCACGTCTCGTTGTTTACATTCGCCCTTGACCTTGATGTGGAGATGGTAAATTTAAGG
ACATTTGCCCAAGAGAAAACAAGAGAGATAAAGACACAACCCCTTGAACAAGGTGACAATCCGGAGGTGGAGAAT
ACGTTGCAACTTACTTCATTGTATTATGGTGGCAGGAAATACGATGAAGTCCCAATAATTGACAGGGACCGTCTA
CGCTCAGGGAATGTTCTGAAGGGTCCCTGCGTCATATACGAGACTGATAGCACGACATTCTTGGCCCCAGGACAT
CGTGCTGAAATAGACCATGTGGCTAATATTCTCATCTGGCCCGATATCTCTGAAAGAATTCCGCTTGGCGTTTCC
TCGACTTTTAATCCCATTGTTGTCCAGCTAGTCGAAGCCGTGCTACAGAACGTGCGCACAGAGATGGATACCCTG
ATTATGCGAGTCGCAATGTCACCCGCCATGCGAGAACAGTTGGATTACTTCCCAATGATAGCCGCTGGAGATGGT
CCACATTCGGGGAAAATGGTCTGTGGTCAATTTGGAAGCTTCATACCAGGCTTTCTTGCATCGTGGGAGGAGTCT
ATCGAAGAAGGTGATATCTTCTTGACAAACGATCCATATTCCTGCAGCAATGCAATCTCTCATTTGAACGACTTT
CTTGTGATCAATCCCGTTCATTATCGCGGAAAATTAGTCGCGTGGATCGCGAATATCGGGCATTTTACAGATATC
GGCTCTTCTGTACCTGGAAGCATGCCAAGTCATGCACGTACTATTCATGAAGATGGAATTCAAATACCCCTTTGC
AAATTATACTCTCGAAATACTCTAAACACCGCAGTATTCAAGATTATTGAAAGGAACAGCAGGAAGCCTGATTTT
ACGAGGAGTGACTTGATAGCCCTGGTAGCAGCGACCAAAATAGCTGCCCGACGGATAAAGGAAATGTGTGAACGT
TTTGGCACTGATGCGTATGAACATGCATTGGATATCCTATTGACGAGAAACAAACTCGCGGTTGGCAAAATCATA
AAGACCACACTTTCGTCTGAGAAAGTGCATTTTGAGGATTACATCGACGACGACGGTCACGGGACAGGTCCTTGG
AGGATTGCATGTACAATGTGGAAAGAAGTGAATGGGGAGGGAGATCATGTTGTTGTCCTCGACTTTGATGGAACG
GATCCCCAATCTGACAAGTCTGTCAACTTTGCGCTGTCCCACGAAATGCTCAAAATGTTTGTGGTTTACTATCTG
CTGACTGTCTTCGATCCGACTACGATTGTGAACGACGGGTCCTTTGAGCTCATTCAAATCAAGGTACCCGAGGGG
ACATTACTAAATCCTGTCTGGCCAGCCGCTCTTTCTGGAAGGACTCCCCTCATCGGCCGTCTTTTCGACGTCTTG
GGAGCCATATTCGGTCAGAGGACGCCGGAATTTCTGTCCGCTGCCGGGTACAGCGATTCGCCTCACTTCTTTTTT
AGTGGATGGAACAGGATGGGAGAGTGGTTTCAGCTCTATCAGATCGGATTTGGCGGCATTCCAGGTCGACCGCAT
GGTGATGGACCAGATGGGCACAGTATGTGGCCTTCTATGAGGTCTGTTCCGAACGAATTTTTGGAAAGCTATCTA
CCTTTACGAGTGGATAAATACCAGACTGTCCCAGATTCGGGGGAGAAGGCTTGTATCGTGGGGGTAACGCCATGC
GCATTGATTATGTGTTCCTCGATTCGGGAAATGTTTCGGTCCAGAAAAACGCTAGTCAGGTATTCTGTCAACCAA
GATAGCCCTCCCCGTGAAATTATCGAGTCCAAGAAAGATTTCCTTGAGGTCTCGGCAGGCGATGTACTTGAGTGG
GTGACTTGGGGAGGTGGAGGATATGGTGATGCTTTACAAAGAGACCCTCACCTAGTGGCCAAGGAAGTTCAACGT
GGACTGGTTGCCGACGCCACACGTTACGGCGTCTGCCTCGATGCTGCGGGAGACGTGGACTTGGAAGCAACGAAA
AGTCTTCGATTAGAGATGAAGCCCCAACAGGATCTATTGTCTAAAGAGATTTTCAACCGAGGAGGGTCTATGAAG
GAGTTGCGGGACCGATGTTTGGAGGAAACTGGTCTGCCCCCGCCTTTTTTACCTTCTGGCAGAAATCTCCGGGGA
CCAATCACGCAGATTCCACACTTGAGAGAGCTACAGGAGCGTAGGAAACGAGAAGACGCTTTATTGTATCAGGCT
TGA
Transcript >Agabi119p4|060760
ATGCGAATGACAGATCAAGGTGTTTGGAAACTGGGTATAGATGTTGGTGGAACGTTTACAGATGCAGTGTTATAC
CATGAAAGCACCGGTGAAATATACAAGGCCAAGGTCCCCAGCACACCCCAAGATCAGAGCGAAGGCGTTCTGAGT
GCTATCGCCTCCCTGCGATCACAAGTACCAGACGGAGAAAACATAAAGATAGCCAGCCTCAATCACGGAACGACT
GTCGCAACCAATGCTGTTCTAGAAGGCAAAGGTGCCAGTGTTGCTTTGTTGGTCACTGAAGGATACAAAGATATC
CTTCAAATACGACGTTCTCATGTGCCCGGAGGACTGGCAGGATGGATCACTTGGTCAAAGCCGGAACCTCTTGCT
CCTCTGGAACTTACTATTGAAGTCCCTGGCCGTATTTCTTCATCGGGAGAAGTCGTTCGCCCCTTCGACGCAGAA
CTTCTCCGGACTCGACTTCAAAAACTCAAGAATTCCAAAACAAGACCAGAATCTATTACGATCTCGCTCATCAAC
TCGTTCGCCAATCCCACACATGAACGTCAAGTTGCCCAACTTGTTCGGACTGAGTTTCCTGGTATACCTCTTTCC
CTCAGCAGTGATGTCTTGCCGGAAATCATGGAATATGAAAGAACAGTGACTACGGTTGCGAATGCCTATGTGAAA
CCCGTCGTTCATCGCTATTTGGCTAATCTCGAGACTGCGTTGAAAGATATACCAGTTAATGTTTTGCGAAGCGAC
GGTGGTCTTTCCGGTGCTAGTATTGCAAAGGAACACTGTGCAACTCTTTTGTACTCGGGACCCGCGGGAGGAGTT
ACTGGTGTAATCAACCAAGTTGCCAGAAGAACAAAATACAAGAATTTGATGTCGTTTGACATGGGAGGTACAAGC
ACCGATGTATGTCTTATTGAAAATGGCAAAGCAGATTTACGTCGGGAAAGTACTATCGGTGATCTGACCATACGC
GCTCCTTCGATCGACGTCCGCACTGTAGGCGCGGGTGGAGGGTCTATCGCTTCTGTTGCCGAAATAACTGGAGCC
CTGCGCGTCGGGCCAGAAAGTGCTGGTGCGATCCCAGGACCCGCATGCTACAGCAAAGGTGGCAATAAAGCCACA
GTCACCGACGCCTTGGCCGTTCTTGGATACTTACCCCCAGCTTTACTCGGAGGTTCCTTCCATCTCGATGTCAAT
GCCGCTTTTAAAGTCATAGAAGAAAACATTGTAAAGCCAATGAAACTTGCTACTGCCGTTGAAGCTGCGGAAGGT
ATCATCCGTATTGCACTCGAGAAAGTTCACGGGAGTTTGCGAAGTGTCAGTGTAGAAAAGGGGAAAGACCCTAGA
GACTATAATCTCGTTAGTTTTGGTGGTGCTGGTGGTTTGGTCGCTTGTGAACTGGCCAAAATATGCGGTGTCGCA
TATCCTCTTATTATTCCTCCATCACCGGGTGTTCTGTGTGCTCTTGGCGAGGCTTATACCGGCATCAGACATGAA
GTTTCGACGACAATGATTCACAAGCTGAAGGACATGAATGTATCGGATTTCCAGGGGGCATGCGATAACCTCAAA
ACCCGAGTCTCCTCGGTACTACTTGAACAAAAAATCATGGACTTTGCGATTGGTTTCGAAGTCGATCTCCGTTTC
CACGGACAAGCCACTAATCTTCCAGTGTCATTTGAACAACAAGAAGTCATTGACCATGGTTTCATTATTCTCGAG
GATCGTTTCAAAGAAAACCACGTCTCGTTGTTTACATTCGCCCTTGACCTTGATGTGGAGATGGTAAATTTAAGG
ACATTTGCCCAAGAGAAAACAAGAGAGATAAAGACACAACCCCTTGAACAAGGTGACAATCCGGAGGTGGAGAAT
ACGTTGCAACTTACTTCATTGTATTATGGTGGCAGGAAATACGATGAAGTCCCAATAATTGACAGGGACCGTCTA
CGCTCAGGGAATGTTCTGAAGGGTCCCTGCGTCATATACGAGACTGATAGCACGACATTCTTGGCCCCAGGACAT
CGTGCTGAAATAGACCATGTGGCTAATATTCTCATCTGGCCCGATATCTCTGAAAGAATTCCGCTTGGCGTTTCC
TCGACTTTTAATCCCATTGTTGTCCAGCTAGTCGAAGCCGTGCTACAGAACGTGCGCACAGAGATGGATACCCTG
ATTATGCGAGTCGCAATGTCACCCGCCATGCGAGAACAGTTGGATTACTTCCCAATGATAGCCGCTGGAGATGGT
CCACATTCGGGGAAAATGGTCTGTGGTCAATTTGGAAGCTTCATACCAGGCTTTCTTGCATCGTGGGAGGAGTCT
ATCGAAGAAGGTGATATCTTCTTGACAAACGATCCATATTCCTGCAGCAATGCAATCTCTCATTTGAACGACTTT
CTTGTGATCAATCCCGTTCATTATCGCGGAAAATTAGTCGCGTGGATCGCGAATATCGGGCATTTTACAGATATC
GGCTCTTCTGTACCTGGAAGCATGCCAAGTCATGCACGTACTATTCATGAAGATGGAATTCAAATACCCCTTTGC
AAATTATACTCTCGAAATACTCTAAACACCGCAGTATTCAAGATTATTGAAAGGAACAGCAGGAAGCCTGATTTT
ACGAGGAGTGACTTGATAGCCCTGGTAGCAGCGACCAAAATAGCTGCCCGACGGATAAAGGAAATGTGTGAACGT
TTTGGCACTGATGCGTATGAACATGCATTGGATATCCTATTGACGAGAAACAAACTCGCGGTTGGCAAAATCATA
AAGACCACACTTTCGTCTGAGAAAGTGCATTTTGAGGATTACATCGACGACGACGGTCACGGGACAGGTCCTTGG
AGGATTGCATGTACAATGTGGAAAGAAGTGAATGGGGAGGGAGATCATGTTGTTGTCCTCGACTTTGATGGAACG
GATCCCCAATCTGACAAGTCTGTCAACTTTGCGCTGTCCCACGAAATGCTCAAAATGTTTGTGGTTTACTATCTG
CTGACTGTCTTCGATCCGACTACGATTGTGAACGACGGGTCCTTTGAGCTCATTCAAATCAAGGTACCCGAGGGG
ACATTACTAAATCCTGTCTGGCCAGCCGCTCTTTCTGGAAGGACTCCCCTCATCGGCCGTCTTTTCGACGTCTTG
GGAGCCATATTCGGTCAGAGGACGCCGGAATTTCTGTCCGCTGCCGGGTACAGCGATTCGCCTCACTTCTTTTTT
AGTGGATGGAACAGGATGGGAGAGTGGTTTCAGCTCTATCAGATCGGATTTGGCGGCATTCCAGGTCGACCGCAT
GGTGATGGACCAGATGGGCACAGTATGTGGCCTTCTATGAGGTCTGTTCCGAACGAATTTTTGGAAAGCTATCTA
CCTTTACGAGTGGATAAATACCAGACTGTCCCAGATTCGGGGGAGAAGGCTTGTATCGTGGGGGTAACGCCATGC
GCATTGATTATGTGTTCCTCGATTCGGGAAATGTTTCGGTCCAGAAAAACGCTAGTCAGGTATTCTGTCAACCAA
GATAGCCCTCCCCGTGAAATTATCGAGTCCAAGAAAGATTTCCTTGAGGTCTCGGCAGGCGATGTACTTGAGTGG
GTGACTTGGGGAGGTGGAGGATATGGTGATGCTTTACAAAGAGACCCTCACCTAGTGGCCAAGGAAGTTCAACGT
GGACTGGTTGCCGACGCCACACGTTACGGCGTCTGCCTCGATGCTGCGGGAGACGTGGACTTGGAAGCAACGAAA
AGTCTTCGATTAGAGATGAAGCCCCAACAGGATCTATTGTCTAAAGAGATTTTCAACCGAGGAGGGTCTATGAAG
GAGTTGCGGGACCGATGTTTGGAGGAAACTGGTCTGCCCCCGCCTTTTTTACCTTCTGGCAGAAATCTCCGGGGA
CCAATCACGCAGATTCCACACTTGAGAGAGCTACAGGAGCGTAGGAAACGAGAAGACGCTTTATTGTATCAGGCT
TGA
Gene >Agabi119p4|060760
ATGCGAATGACAGATCAAGGTGTTTGGAAACTGGGTATAGATGTTGGTGGAACGTTTACAGATGCAGTGTTATAC
CATGAAAGCACCGGTGAAATATACAAGGCCAAGGTACAGCAGTTGTTATAATACTTGCACTGCATTCAAACAATG
AATAGGTCCCCAGCACACCCCAAGATCAGAGCGAAGGCGTTCTGAGTGCTATCGCCTCCCTGCGGTACGGCATGT
TTTCCGGATTGTCAGGGTTCATGCTTACTCGATATCCCTTTTAGATCACAAGTACCAGACGGAGAAAACATAAAG
ATAGCCAGCCTCAATCACGGTTAGTTCTATCAATCTCGTACTATTATTGAAACTATATGCATAAGCTTTCCTAGG
AACGACTGTCGCAACCAATGCTGTTCTAGAAGGCAAAGGTGCCAGTGTTGCTTTGTTGGTCACTGAAGGATACAA
AGATATCCTTCAAATACGACGTTCTCATGTGCCCGGAGGACTGGCAGGATGGTGGGTGTTAGTTGTTTAGGGTCG
TAGACCCTTTCTGGCAACAGATTCACTACCCTTACGTACAGGATCACTTGGTCAAAGCCGGAACCTCTTGCTCCT
CTGGAACTTGTAAGATATTCTGCTCTTACTTGAGAATTATACTCCACTGAATGAGTAGACTATTGAAGTCCCTGG
CCGTATTTCTTCATCGGGAGAAGTCGTTCGCCCCTTCGACGCAGAACTTCTCCGGACTCGACTTCAAAAACTCAA
GAATTCCAAAACAAGACCAGAATCTATTACGATCTCGCTCATCAACTCGTTCGCCAATCCCACACATGAACGTCA
AGTTGCCCAACTTGTTCGGACTGAGTTTCCTGGTATACCTCTTTCCCTCAGCAGTGATGTCTTGCCGGAAATCAT
GGAATATGAAAGAACAGTGACTACGGTTGCGAATGCCTATGTGAAACCCGTCGTTCATCGCTATTTGGCTAATCT
CGAGACTGCGTTGAAAGATATACCAGTTAATGTTTTGCGAAGCGACGGTGGTCTTTCCGGTGCTAGTATTGCAAA
GGAACACTGTGCAACTCTTTTGTACTCGGTGTGTCGGCCGTTCTCTTGACCTCAAGTCAGTACTAAGTTTTTTTA
TGCAGGGACCCGCGGGAGGAGTTACTGGTGTAATCAACCAAGTTGCCAGAAGAACAAAATACAAGGTAGTGAAAT
AGAGAGGACTCTCCAACCAAGCTTGCTAACACTGACAGAATTTGATGTCGTTTGACATGGGAGGTACAAGCACCG
ATGTATGTCTTATTGAAAATGGCAAAGCAGATTTACGTCGGGAAAGTACTATCGGTGATCTGACCAGTAAGTCCC
GACCATCAAAAGCTCCATCTTGCCCTGATGTTCTTCAGTACGCGCTCCTTCGATCGACGTCCGCACTGTAGGCGC
GGGTGGAGGGTCTATCGCTTCTGTTGCCGAAATAACTGGAGCCCTGCGCGTCGGGCCAGAAAGTGCTGGTGCGAT
CCCAGGACCCGCATGCTACAGCAAAGGTGGCAATAAAGCCACAGTCACCGACGCCTTGGCCGTTCTTGGATACTT
ACCCCCAGCTTTACTCGGAGGTTCCTTCCATCTCGATGTCAATGCCGCTTTTAAAGTCATAGAAGAAAACATTGT
AAAGCCAATGAAACTTGCTACTGCCGTTGAAGCTGCGGAAGGTATCATCCGTATTGCACTCGAGAAAGTTCACGG
GAGTTTGCGAAGTGTCAGTGTAGAAAAGGGGAAAGACCCTAGAGACTATAATCTCGTTAGTTTTGGTGGTGCTGG
TGGTTTGGTCGCTTGTGAACTGGCCAAAATATGCGGTGTCGCATATCCTCTTATTATTCCTCCATCACCGGGTGG
TATGTCGTATTGTATACCATCACTTATGATAGGCTGACTCTTCTAGTTCTGTGTGCTCTTGGCGAGGCTTATACC
GGCATCAGACATGAAGTTTCGACGACAATGATTCACAAGCTGAAGGACATGAATGTATCGGATTTCCAGGGGGCA
TGCGATAACCTCAAAACCCGAGTCTCCTCGGTACTACTTGAACAAAAAATCATGGACTTTGCGATTGGTTTCGAA
GTCGATCTCCGTTTCCACGGACAAGCCACTAATCTTCCAGTGTCATTTGAACAACAAGAAGTCATTGACCATGGT
TTCATTATTCTCGAGGATCGGCGAGTCTTTCTTACGGCGGTGGAAATTAATACTCATGCCACATATTAGTTTCAA
AGAAAACCACGTCTCGTTGTTTACATTCGCCCTTGACCTTGATGTGGAGATGGTAAATTTAAGGACATTTGCCCA
AGAGAAAACAAGAGAGATAAAGACACAACCCCTTGAACAAGGTGACAATCCGGAGGTGGAGAATACGTTGCAACT
TACTTCATTGGTAATGCAAGTGATTCATGAAAGAGTATTGCCTGCTCATCCTAGCATCTAGTATTATGGTGGCAG
GAAATACGATGAAGTCCCAATAATTGACAGGGACCGTCTACGCTCAGGGAATGTTCTGAAGGGTCCCTGCGTCAT
ATACGAGGTAAGGCAAGAGTTATTCTTTTCCGTCTTCATCCAGCTCAAGATTTCGTGCAGACTGATAGCACGACA
TTCTTGGCCCCAGGACATCGTGCTGAAATAGACCATGTGGCTAATATTCTCATCTGGCCCGATATCTCTGAAAGA
ATTCCGCTTGGCGTTTCCTCGACTTTTAATCCCATTGTTGTCCAGCTAGTCGAAGGTGTGGAATTTATTGAGTGC
TTGATGTTGCCCACAGTCAATTGTTGAGCCTCTTCCCTGCACAGCCGTGCTACAGAACGTGCGCACAGAGATGGA
TACCCTGATTATGCGAGTCGCAATGTCACCCGCCATGCGAGAACAGGTCCGTATTTTTAAGCTCTTCTCGCTAGC
CTGGGGGTTCATTCAAAGTGCTCTAGTTGGATTACTTCCCAATGATAGCCGCTGGAGATGGTCCACATTCGGGGA
AAATGGTCTGTGGTCAATTTGGAAGCTTCATACCAGGTAAGTGGTTTACATCACCGAGATTCTCAAGTCTTTACC
TAAAGCATGCCCAGGCTTTCTTGCATCGTGGGAGGAGTCTATCGAAGAAGGTTAAATCCCATTTTCTTGCAGCTG
AGTCGACTGATCAATGTTCGTATACCTGGTTAGGTGATATCTTCTTGACAAACGATCCATATTCCTGCAGCAATG
CAATCTCTCATTTGAACGACTTTCTTGTGATCAATCCCGTTCATTATCGCGGAAAATTAGTCGCGTGGATCGCGA
ATATCGGGCATTTTACAGATATCGGCTCTTCTGTACCTGGAAGCATGCCAAGTCAGTCATTTTCAGGGCATCTAT
GCAAATCAAATATGACTTAATGGTAGAATTGCAGGTCATGCACGTACTATTCATGAAGATGGAATTCAAATACCC
CTTTGCAAATTATACTCTCGAAATACTCTAAACACCGCAGTATTCAAGGTGCGTGCTTTCAAAATACGCAAATTA
TGGGCTTTGATGTGTTCCCAGATTATTGAAAGGAACAGCAGGAAGCCTGATTTTACGAGGAGTGACTTGATAGCC
CTGGTAGCAGCGACCAAAATAGCTGCCCGACGGATAAAGGAAATGTGTGAACGTTTTGGCACTGATGCGTATGAA
CATGCATTGGATATCCTATTGACGAGAAACAAACTCGCGGTTGGCAAAATCATAAAGACCACACTTTCGTCTGAG
AAAGTGCATTTTGAGGATTACATCGACGACGACGGTCACGGGACAGGTCCTTGGAGGATTGCATGGTAGCGTCTG
CTTTCAGTTTGTGCTGCTAGTGAAGTGCTGACTAGTATATATGAAGTACAATGTGGAAAGAAGTGAATGGGGAGG
GAGATCATGTTGTTGTCCTCGACTTTGATGGAACGGATCCCCAATCTGACAAGTCTGTCAACTTTGCGCTGTCCC
ACGAAATGCTCAAAATGTTTGTGGTTTACTATCTGCTGACTGTCTTCGTGAGTGCGCCCCAATAGCACGACAAGG
CTTCTTTAATAGTGTTCCCCTTCAGGATCCGACTACGATTGTGAACGACGGGTCCTTTGAGCTCATTCAAATCAA
GGTACCCGAGGGGACATTACTAAATCCTGTCTGGCCAGCCGCTCTTTCTGGAAGGACTCCCCTCATCGGCCGTCT
TTTCGACGTCTTGGGAGCCATATTCGGTCAGAGGACGCCGGAATTTCTGTCCGCTGCCGGGTACAGCGATTCGCC
TCACTTCTTTTTTAGTGGATGGAACAGGATGGGAGAGTGGTTTCAGGTAAGCAGCCTCTCTGGTCTAGAAATTCG
CATACTGAAAGATCGAGAGTAGCTCTATCAGATCGGATTTGGCGTTGGCGATTCACTTCTATGACCTTGCCATGA
TGCACTGAAATTGATGTATAGGGCATTCCAGGTCGACCGCATGGTGATGGACCAGATGGGCACAGTATGTGGCCT
TCTATGAGGTCTGTTCCGAACGAATTTTTGGAAAGCTATCTACCTTTACGAGTGGATAAATACCAGGCAAGCAGA
CGTTTTGCCTTGTCCCGAGATGCCTGGAATTAAAGCTCTGCTAGACTGTCCCAGATTCGGGGGAGAAGGCTTGTA
TCGTGGGGGTAACGCCATGCGCATTGGTGGGTCCTGACATGGTGGCCAATGAGATGATTAATCTTTGATTAATTA
GATTATGTGTTCCTCGATTCGGGAAATGTTTCGGTGCATGATGATCGATGGTATACTAAACCTTGGGGTGTAAAT
GGTGGCGGCGTCGGAGCTAGGTCCAGAAAAACGCTAGTCAGGTATTCTGTCAACCAAGATAGCCCTCCCCGTGAA
ATTATCGAGTCCAAGAAAGATTTCCTTGAGGTAATCTATCCACTATTCAAGTCGATGTCGAATATGAAATGTTTT
AGGTCTCGGCAGGCGATGTACTTGAGTGGGTGACTTGGGGAGGTAAGTCGGATGATTGCTGTATAAGCTACTTGA
CTGACGGACGCAACCCGTTAGGTGGAGGATAGTAAGTTGTGCTATGTCATCCCGAGCGTGAAGCCTGAAATATTC
TTAGTGGTGATGCTTTACAAAGAGACCCTCACCTAGTGGCCAAGGAAGTTCAACGTGGACTGGTTGCCGACGCCA
CACGTTACGGCGTCTGCCTCGATGCTGCGGGAGACGTGGACTTGGAAGCAACGAAAAGTCTTCGATTAGAGATGA
AGCCCCAACAGGATCTATTGTCTAAAGAGATTTTCAACCGAGGAGGGTCTATGAAGGAGTTGCGGGACCGATGTT
TGGAGGAAACTGGTCTGCCCCCGCCTTTTTTACCTTCTGGCAGAAATCTCCGGGGACCAATCACGCAGATTCCAC
ACTTGAGAGAGCTACAGGAGCGTAGGAAACGAGAAGACGCTTTATTGTATCAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail