Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|060750
Gene name
Locationscaffold_03b:77367..78662
Strand-
Gene length (bp)1295
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 2.0E-16 3 107

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|060750
MSLLVIYNPVAGSGSAKLLIDEHILPALQPDHTIDGILSTEHAGHAGTFVAEYARDHSTHNLTIILASGDGTLHE
IIDSLSLAKATHGRVSFVLVPAGTANALYSSLFPPASQEMIDDVAYKLQSLRLYLNGKGTVRSLTYSLTEFFPSP
TAQVNPRVASSCVVTSTSLHASILYDSELLRKEIPGIERFKVAAHKNGKRWYHATARLLPCSSSAVQIWDPVSHS
FVEHPESTKVSPVVEFKGPFIYFLSTINVDRLETEFIITPLAQEVPPASNTCDIVIVRPLRDPSIGEEGEKGREQ
FVDKIWGVMGGAYKRGSHIDLRYDHNGHIVNDGDGPLVVEYIRCGGWEWIPDDEDKRANLVCADGEVLEIEHGGK
AVSRVCDAISNLVLGVYCDKE*
Coding >Agabi119p4|060750
ATGTCTCTCCTTGTCATATATAACCCGGTTGCTGGCTCCGGCTCTGCCAAGCTTCTGATAGACGAACACATACTC
CCTGCTCTCCAACCTGATCATACCATCGATGGCATCTTATCTACGGAACATGCGGGGCACGCGGGGACCTTTGTG
GCAGAATATGCCCGGGATCATTCTACTCATAACCTCACGATTATTCTCGCGTCTGGTGATGGAACTCTACATGAA
ATCATCGACTCTCTATCCTTAGCTAAAGCAACCCATGGTCGCGTGTCGTTTGTCTTGGTACCGGCAGGAACAGCC
AATGCGCTTTATTCTTCCCTATTCCCTCCCGCTTCTCAGGAAATGATCGACGATGTTGCATACAAGCTACAATCT
CTTCGCCTATACCTGAATGGAAAGGGCACCGTTCGATCCCTCACATATTCTTTGACAGAGTTCTTTCCAAGTCCA
ACGGCTCAGGTAAATCCGAGGGTCGCCTCCTCCTGCGTCGTCACGTCTACATCACTTCATGCTTCAATCCTCTAT
GATTCAGAGCTGTTGAGGAAGGAGATTCCAGGCATTGAAAGATTCAAGGTGGCCGCTCATAAAAACGGCAAACGC
TGGTACCATGCAACAGCCAGATTACTCCCTTGCTCCTCGAGCGCTGTGCAAATATGGGATCCGGTTTCCCATTCA
TTTGTGGAACATCCGGAATCGACAAAAGTGAGCCCTGTCGTGGAATTCAAAGGACCGTTCATCTACTTTCTCTCA
ACCATTAACGTCGACCGACTGGAAACCGAGTTCATAATTACCCCTTTGGCACAAGAGGTGCCACCAGCCAGTAAT
ACATGTGATATCGTCATTGTGCGACCGTTGCGCGACCCTTCCATTGGCGAGGAAGGAGAGAAAGGAAGAGAACAA
TTTGTAGACAAGATATGGGGAGTGATGGGAGGCGCGTACAAAAGAGGATCACATATCGACTTGAGATATGATCAC
AATGGTCATATTGTCAACGATGGAGACGGACCTTTAGTGGTGGAATATATCAGATGTGGAGGATGGGAATGGATA
CCAGATGACGAGGACAAGAGAGCAAATCTTGTTTGTGCTGATGGAGAGGTGCTTGAGATAGAGCATGGGGGAAAA
GCGGTCTCGCGAGTATGCGATGCAATTTCTAACTTGGTACTTGGAGTATATTGCGATAAAGAGTGA
Transcript >Agabi119p4|060750
ATGTCTCTCCTTGTCATATATAACCCGGTTGCTGGCTCCGGCTCTGCCAAGCTTCTGATAGACGAACACATACTC
CCTGCTCTCCAACCTGATCATACCATCGATGGCATCTTATCTACGGAACATGCGGGGCACGCGGGGACCTTTGTG
GCAGAATATGCCCGGGATCATTCTACTCATAACCTCACGATTATTCTCGCGTCTGGTGATGGAACTCTACATGAA
ATCATCGACTCTCTATCCTTAGCTAAAGCAACCCATGGTCGCGTGTCGTTTGTCTTGGTACCGGCAGGAACAGCC
AATGCGCTTTATTCTTCCCTATTCCCTCCCGCTTCTCAGGAAATGATCGACGATGTTGCATACAAGCTACAATCT
CTTCGCCTATACCTGAATGGAAAGGGCACCGTTCGATCCCTCACATATTCTTTGACAGAGTTCTTTCCAAGTCCA
ACGGCTCAGGTAAATCCGAGGGTCGCCTCCTCCTGCGTCGTCACGTCTACATCACTTCATGCTTCAATCCTCTAT
GATTCAGAGCTGTTGAGGAAGGAGATTCCAGGCATTGAAAGATTCAAGGTGGCCGCTCATAAAAACGGCAAACGC
TGGTACCATGCAACAGCCAGATTACTCCCTTGCTCCTCGAGCGCTGTGCAAATATGGGATCCGGTTTCCCATTCA
TTTGTGGAACATCCGGAATCGACAAAAGTGAGCCCTGTCGTGGAATTCAAAGGACCGTTCATCTACTTTCTCTCA
ACCATTAACGTCGACCGACTGGAAACCGAGTTCATAATTACCCCTTTGGCACAAGAGGTGCCACCAGCCAGTAAT
ACATGTGATATCGTCATTGTGCGACCGTTGCGCGACCCTTCCATTGGCGAGGAAGGAGAGAAAGGAAGAGAACAA
TTTGTAGACAAGATATGGGGAGTGATGGGAGGCGCGTACAAAAGAGGATCACATATCGACTTGAGATATGATCAC
AATGGTCATATTGTCAACGATGGAGACGGACCTTTAGTGGTGGAATATATCAGATGTGGAGGATGGGAATGGATA
CCAGATGACGAGGACAAGAGAGCAAATCTTGTTTGTGCTGATGGAGAGGTGCTTGAGATAGAGCATGGGGGAAAA
GCGGTCTCGCGAGTATGCGATGCAATTTCTAACTTGGTACTTGGAGTATATTGCGATAAAGAGTGA
Gene >Agabi119p4|060750
ATGTCTCTCCTTGTCATATATAACCCGGTTGCTGGCTCCGGCTCTGCCAAGCTTCTGATAGACGAACACATACTC
CCTGCTCTCCAACCTGATCATACCATCGATGGCATCTTATCTACGGAACATGCGGGGCACGCGGGGACCTTTGTG
GCAGAATATGCCCGGGATCATTCTACTCATAACCTCACGATTATTCTCGCGTCTGGTGATGGAACTCTACATGAA
ATCATCGACTCTCTATCCTTAGCTAAAGCAACCCATGGTCGCGTGTCGTTTGTCTTGGTACCGGCAGGAACAGCC
AATGCGCTTTATTCTTCCCTATTCCCTCCCGCTTCTCAGGAAATGATCGACGATGTTGCATACAAGCTACAATCT
CTTCGCCTATACCTGAATGGAAAGGGCACCGTTCGATCCCTCACATATTCTTTGACAGAGTTCTTTCCAAGTCCA
ACGGCTCAGGTAAATCCGAGGGTCGCCTCCTCCTGCGTCGTCACGTCTACATCACTTCATGCTTCAATCCTCTAT
GATTCAGAGCTGTTGAGGAAGGAGATTCCAGGCATTGAAAGGCATAGACTCAATTTTACCTAGATAGAGTCGAAC
TCTAACAGTCATTCGCAGATTCAAGGTGGCCGCTCATAAAAACGGCAAACGCTGGTACCATGCAACAGCCAGATT
ACTCCCTTGCTCCTCGAGCGCTGTGCAAATATGGGATCCGGTTTCCCATTCATTTGTGGAACATCCGGAATCGAC
AAAAGTGAGCCCTGTCGTGGAATTCAAAGGACCGTTCATCTACTTTCTCTCAACCATTAACGTCGACCGACTGGA
AACCGAGTTCATAATTACCCCTTTGGCACAAGAGGTGCCACCAGCCAGTAATACATGTGATATCGTCATTGTGCG
ACCGTTGCGCGACCCTTCCATTGGCGAGGAAGGAGAGAAAGGAAGAGAACAATTTGTAGACAAGATATGGGGAGT
GATGGGAGGCGCGTACAAAAGAGGATCACATATCGACTTGAGATATGATCACAATGGTCATATTGTCAACGATGG
AGACGGACCTTTAGTGGTGGAATATATCAGATGTGGAGGATGGGAATGGATACCAGTAGGTTCTTTATGGTCTGT
TTCAAGTACAACTCAGGATGCGAGCATCTTAGGATGACGAGGACAAGAGAGCAAATCTTGTTTGTGCTGATGGAG
AGGTGCTTGAGATAGAGCATGGGGGAAAAGCGGTCTCGCGAGTATGCGATGCAATTTCTAACTTGGTACTTGGAG
TATATTGCGATAAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail