Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|059510
Gene name
Locationscaffold_03a:1693568..1695003
Strand+
Gene length (bp)1435
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01137 RTC RNA 3'-terminal phosphate cyclase 1.3E-79 13 395
PF05189 RTC_insert RNA 3'-terminal phosphate cyclase (RTC), insert domain 2.2E-18 213 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R3J0|RTCA_MACFA RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis GN=RTCA PE=2 SV=1 8 413 2.0E-84
sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens GN=RTCA PE=1 SV=1 8 413 2.0E-84
sp|Q2HJ88|RTCA_BOVIN RNA 3'-terminal phosphate cyclase OS=Bos taurus GN=RTCA PE=2 SV=1 8 413 4.0E-84
sp|Q9D7H3|RTCA_MOUSE RNA 3'-terminal phosphate cyclase OS=Mus musculus GN=RtcA PE=1 SV=2 8 413 8.0E-84
sp|Q5R7P3|RTCA_PONAB RNA 3'-terminal phosphate cyclase OS=Pongo abelii GN=RTCA PE=2 SV=1 8 413 5.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R3J0|RTCA_MACFA RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis GN=RTCA PE=2 SV=1 8 413 2.0E-84
sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens GN=RTCA PE=1 SV=1 8 413 2.0E-84
sp|Q2HJ88|RTCA_BOVIN RNA 3'-terminal phosphate cyclase OS=Bos taurus GN=RTCA PE=2 SV=1 8 413 4.0E-84
sp|Q9D7H3|RTCA_MOUSE RNA 3'-terminal phosphate cyclase OS=Mus musculus GN=RtcA PE=1 SV=2 8 413 8.0E-84
sp|Q5R7P3|RTCA_PONAB RNA 3'-terminal phosphate cyclase OS=Pongo abelii GN=RTCA PE=2 SV=1 8 413 5.0E-82
sp|O77264|RTCA_DROME RNA 3'-terminal phosphate cyclase OS=Drosophila melanogaster GN=CG4061 PE=2 SV=1 8 411 1.0E-69
sp|A1RSJ7|RTCA_PYRIL RNA 3'-terminal phosphate cyclase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rtcA PE=3 SV=1 8 413 3.0E-69
sp|O15746|RTCA_DICDI Probable RNA 3'-terminal phosphate cyclase OS=Dictyostelium discoideum GN=rtca PE=3 SV=1 8 412 4.0E-68
sp|B1YDJ1|RTCA_PYRNV RNA 3'-terminal phosphate cyclase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rtcA PE=3 SV=1 8 412 6.0E-67
sp|A3DN24|RTCA_STAMF RNA 3'-terminal phosphate cyclase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rtcA PE=3 SV=2 8 413 4.0E-64
sp|Q8ZST4|RTCA_PYRAE RNA 3'-terminal phosphate cyclase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rtcA PE=3 SV=1 8 413 7.0E-64
sp|A3MXQ7|RTCA_PYRCJ RNA 3'-terminal phosphate cyclase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rtcA PE=3 SV=1 8 411 2.0E-63
sp|Q5JIQ0|RTCA_THEKO RNA 3'-terminal phosphate cyclase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rtcA PE=3 SV=1 8 398 1.0E-55
sp|A0B532|RTCA_METTP RNA 3'-terminal phosphate cyclase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rtcA PE=3 SV=2 8 411 2.0E-55
sp|Q46DV9|RTCA_METBF RNA 3'-terminal phosphate cyclase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rtcA PE=3 SV=1 8 399 1.0E-54
sp|Q8TZC9|RTCA_METKA RNA 3'-terminal phosphate cyclase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rtcA PE=3 SV=1 8 411 2.0E-54
sp|Q8PXC4|RTCA_METMA RNA 3'-terminal phosphate cyclase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rtcA PE=3 SV=1 8 399 4.0E-53
sp|A8MAV7|RTCA_CALMQ RNA 3'-terminal phosphate cyclase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rtcA PE=3 SV=1 8 394 1.0E-52
sp|B6YSJ5|RTCA_THEON RNA 3'-terminal phosphate cyclase OS=Thermococcus onnurineus (strain NA1) GN=rtcA PE=3 SV=1 7 398 1.0E-52
sp|A8A9W2|RTCA_IGNH4 RNA 3'-terminal phosphate cyclase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rtcA PE=3 SV=1 8 410 1.0E-52
sp|C5A2A3|RTCA_THEGJ RNA 3'-terminal phosphate cyclase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rtcA PE=3 SV=1 8 398 2.0E-52
sp|Q60335|RTCA_METJA RNA 3'-terminal phosphate cyclase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rtcA PE=3 SV=1 7 397 3.0E-52
sp|Q8U0N7|RTCA_PYRFU RNA 3'-terminal phosphate cyclase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rtc PE=1 SV=1 7 396 3.0E-52
sp|O27937|RTCA_METTH RNA 3'-terminal phosphate cyclase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rtcA PE=3 SV=1 7 407 7.0E-52
sp|Q8TH85|RTCA_METAC RNA 3'-terminal phosphate cyclase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rtcA PE=3 SV=1 8 399 7.0E-51
sp|B8D680|RTCA_DESK1 RNA 3'-terminal phosphate cyclase OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rtcA PE=3 SV=1 8 412 2.0E-50
sp|O28837|RTCA_ARCFU RNA 3'-terminal phosphate cyclase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rtcA PE=3 SV=1 8 384 1.0E-49
sp|B1L6E9|RTCA_KORCO RNA 3'-terminal phosphate cyclase OS=Korarchaeum cryptofilum (strain OPF8) GN=rtcA PE=3 SV=1 8 414 8.0E-49
sp|Q9YES0|RTCA_AERPE RNA 3'-terminal phosphate cyclase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rtcA PE=3 SV=2 7 401 4.0E-48
sp|A2BN21|RTCA_HYPBU RNA 3'-terminal phosphate cyclase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rtcA PE=3 SV=1 7 389 5.0E-48
sp|O59198|RTCA_PYRHO RNA 3'-terminal phosphate cyclase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rtcA PE=1 SV=2 8 395 1.0E-47
sp|Q974U1|RTCA_SULTO RNA 3'-terminal phosphate cyclase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rtcA PE=1 SV=1 8 398 4.0E-47
sp|O66884|RTCA_AQUAE RNA 3'-terminal phosphate cyclase OS=Aquifex aeolicus (strain VF5) GN=rtcA PE=3 SV=1 8 400 1.0E-46
sp|Q2Y720|RTCA_NITMU RNA 3'-terminal phosphate cyclase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rtcA PE=3 SV=1 5 398 2.0E-46
sp|Q9V0Z6|RTCA_PYRAB RNA 3'-terminal phosphate cyclase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rtcA PE=3 SV=1 8 398 7.0E-46
sp|Q12V70|RTCA_METBU RNA 3'-terminal phosphate cyclase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rtcA PE=3 SV=1 8 400 3.0E-44
sp|Q4JB78|RTCA_SULAC RNA 3'-terminal phosphate cyclase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rtcA PE=3 SV=1 8 396 3.0E-43
sp|C6A4N4|RTCA_THESM RNA 3'-terminal phosphate cyclase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rtcA PE=3 SV=1 5 398 3.0E-43
sp|B7KCF3|RTCA_CYAP7 RNA 3'-terminal phosphate cyclase OS=Cyanothece sp. (strain PCC 7424) GN=rtcA PE=3 SV=1 8 399 6.0E-41
sp|A4YEC3|RTCA_METS5 RNA 3'-terminal phosphate cyclase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rtcA PE=3 SV=1 8 396 3.0E-40
sp|Q3M6L1|RTCA_ANAVT RNA 3'-terminal phosphate cyclase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rtcA PE=3 SV=1 8 399 2.0E-39
sp|B2IWJ8|RTCA_NOSP7 RNA 3'-terminal phosphate cyclase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rtcA PE=3 SV=1 8 399 3.0E-39
sp|Q8YVS3|RTCA_NOSS1 RNA 3'-terminal phosphate cyclase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rtcA PE=3 SV=1 8 399 2.0E-38
sp|C3N969|RTCA_SULIY RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rtcA PE=3 SV=1 8 395 7.0E-37
sp|C3MKC1|RTCA_SULIL RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rtcA PE=3 SV=1 8 395 7.0E-37
sp|C4KKE6|RTCA_SULIK RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rtcA PE=3 SV=1 8 395 7.0E-37
sp|C3NMT8|RTCA_SULIN RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rtcA PE=3 SV=1 8 395 7.0E-37
sp|C3N179|RTCA_SULIA RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain M.16.27) GN=rtcA PE=3 SV=1 8 395 1.0E-36
sp|Q609M1|RTCA_METCA RNA 3'-terminal phosphate cyclase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rtcA PE=3 SV=1 8 409 1.0E-36
sp|C3MU91|RTCA_SULIM RNA 3'-terminal phosphate cyclase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rtcA PE=3 SV=1 8 395 1.0E-36
sp|Q4KEB8|RTCA_PSEF5 RNA 3'-terminal phosphate cyclase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rtcA PE=3 SV=2 8 408 8.0E-36
sp|Q97W04|RTCA_SULSO RNA 3'-terminal phosphate cyclase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rtcA PE=3 SV=2 8 395 2.0E-35
sp|Q8Y2V6|RTCA_RALSO RNA 3'-terminal phosphate cyclase OS=Ralstonia solanacearum (strain GMI1000) GN=rtcA PE=3 SV=1 8 398 4.0E-33
sp|Q1IS76|RTCA_KORVE RNA 3'-terminal phosphate cyclase OS=Koribacter versatilis (strain Ellin345) GN=rtcA PE=3 SV=1 4 400 5.0E-31
sp|Q1R5L5|RTCA_ECOUT RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain UTI89 / UPEC) GN=rtcA PE=3 SV=2 8 399 7.0E-31
sp|A1AGU3|RTCA_ECOK1 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O1:K1 / APEC GN=rtcA PE=3 SV=2 8 399 7.0E-31
sp|B7MDP5|RTCA_ECO45 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rtcA PE=3 SV=1 8 399 7.0E-31
sp|B7N1J7|RTCA_ECO81 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O81 (strain ED1a) GN=rtcA PE=3 SV=1 8 399 8.0E-31
sp|B1IP46|RTCA_ECOLC RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rtcA PE=3 SV=1 8 399 2.0E-30
sp|A8A5M8|RTCA_ECOHS RNA 3'-terminal phosphate cyclase OS=Escherichia coli O9:H4 (strain HS) GN=rtcA PE=3 SV=1 8 399 2.0E-30
sp|B0R414|RTCA_HALS3 RNA 3'-terminal phosphate cyclase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rtcA PE=3 SV=1 5 398 3.0E-30
sp|Q9HRE8|RTCA_HALSA RNA 3'-terminal phosphate cyclase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rtcA PE=3 SV=2 5 398 3.0E-30
sp|Q0TC48|RTCA_ECOL5 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rtcA PE=3 SV=1 8 399 4.0E-30
sp|B5YTX2|RTCA_ECO5E RNA 3'-terminal phosphate cyclase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rtcA PE=3 SV=1 8 399 5.0E-30
sp|P58127|RTCA_ECO57 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O157:H7 GN=rtcA PE=3 SV=1 8 399 5.0E-30
sp|A7ZSU9|RTCA_ECO24 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rtcA PE=3 SV=1 8 399 6.0E-30
sp|B7UKC4|RTCA_ECO27 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rtcA PE=3 SV=1 8 399 7.0E-30
sp|Q8FCS8|RTCA_ECOL6 RNA 3'-terminal phosphate cyclase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rtcA PE=3 SV=2 8 399 7.0E-30
sp|P46849|RTCA_ECOLI RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain K12) GN=rtcA PE=1 SV=3 8 399 7.0E-30
sp|B1X765|RTCA_ECODH RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain K12 / DH10B) GN=rtcA PE=3 SV=1 8 399 7.0E-30
sp|C4ZVX1|RTCA_ECOBW RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rtcA PE=3 SV=1 8 399 7.0E-30
sp|B2U3M8|RTCA_SHIB3 RNA 3'-terminal phosphate cyclase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rtcA PE=3 SV=1 8 399 1.0E-29
sp|B7L4U9|RTCA_ECO55 RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain 55989 / EAEC) GN=rtcA PE=3 SV=1 8 399 1.0E-29
sp|Q31VL3|RTCA_SHIBS RNA 3'-terminal phosphate cyclase OS=Shigella boydii serotype 4 (strain Sb227) GN=rtcA PE=3 SV=2 8 399 1.0E-29
sp|B7NMI4|RTCA_ECO7I RNA 3'-terminal phosphate cyclase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rtcA PE=3 SV=1 8 399 2.0E-29
sp|B7LSC2|RTCA_ESCF3 RNA 3'-terminal phosphate cyclase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rtcA PE=3 SV=1 8 399 3.0E-29
sp|B7M2I0|RTCA_ECO8A RNA 3'-terminal phosphate cyclase OS=Escherichia coli O8 (strain IAI1) GN=rtcA PE=3 SV=1 8 399 4.0E-29
sp|B7V0C8|RTCA_PSEA8 RNA 3'-terminal phosphate cyclase OS=Pseudomonas aeruginosa (strain LESB58) GN=rtcA PE=3 SV=1 1 401 7.0E-29
sp|B1LI80|RTCA_ECOSM RNA 3'-terminal phosphate cyclase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rtcA PE=3 SV=1 8 399 1.0E-28
sp|Q9HVJ9|RTCA_PSEAE RNA 3'-terminal phosphate cyclase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rtcA PE=3 SV=1 1 401 1.0E-28
sp|Q02G92|RTCA_PSEAB RNA 3'-terminal phosphate cyclase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rtcA PE=3 SV=1 1 401 1.0E-28
sp|B7NE24|RTCA_ECOLU RNA 3'-terminal phosphate cyclase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rtcA PE=3 SV=1 8 399 1.0E-28
sp|A4XRJ0|RTCA_PSEMY RNA 3'-terminal phosphate cyclase OS=Pseudomonas mendocina (strain ymp) GN=rtcA PE=3 SV=1 8 399 1.0E-28
sp|Q3YWK6|RTCA_SHISS RNA 3'-terminal phosphate cyclase OS=Shigella sonnei (strain Ss046) GN=rtcA PE=3 SV=2 8 399 2.0E-28
sp|Q32AN4|RTCA_SHIDS RNA 3'-terminal phosphate cyclase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rtcA PE=3 SV=2 8 399 2.0E-28
sp|B5R7J6|RTCA_SALG2 RNA 3'-terminal phosphate cyclase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rtcA PE=3 SV=1 8 402 2.0E-26
sp|B5R378|RTCA_SALEP RNA 3'-terminal phosphate cyclase OS=Salmonella enteritidis PT4 (strain P125109) GN=rtcA PE=3 SV=1 8 402 2.0E-26
sp|B4TKU5|RTCA_SALHS RNA 3'-terminal phosphate cyclase OS=Salmonella heidelberg (strain SL476) GN=rtcA PE=3 SV=1 8 402 6.0E-26
sp|Q8ZLI0|RTCA_SALTY RNA 3'-terminal phosphate cyclase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rtcA PE=3 SV=1 8 402 4.0E-25
sp|B5F8N4|RTCA_SALA4 RNA 3'-terminal phosphate cyclase OS=Salmonella agona (strain SL483) GN=rtcA PE=3 SV=1 8 236 3.0E-24
sp|C0Q0J3|RTCA_SALPC RNA 3'-terminal phosphate cyclase OS=Salmonella paratyphi C (strain RKS4594) GN=rtcA PE=3 SV=1 8 236 2.0E-23
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 16 412 3.0E-22
sp|P56175|RCL1_DROME Probable RNA 3'-terminal phosphate cyclase-like protein OS=Drosophila melanogaster GN=Rtc1 PE=2 SV=3 11 362 1.0E-10
sp|Q23400|RCL1_CAEEL Probable RNA 3'-terminal phosphate cyclase-like protein OS=Caenorhabditis elegans GN=ZK1127.5 PE=3 SV=2 16 399 3.0E-10
sp|Q9C578|RCL1_ARATH Probable RNA 3'-terminal phosphate cyclase-like protein OS=Arabidopsis thaliana GN=At5g22100 PE=2 SV=1 16 412 8.0E-10
sp|Q54S38|RCL1_DICDI Probable RNA 3'-terminal phosphate cyclase-like protein OS=Dictyostelium discoideum GN=rcl1 PE=1 SV=2 16 412 1.0E-08
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 11 413 3.0E-07
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 16 362 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|059510
MSPHLQIINGSILEGGGQILRNSVSLSALLQKPIRIENIRAGRSQPGLKNQHRTGLDLVARIASAQLTGATNGST
NVEFKPGRIELPGSWKADTVTAGATTLLIQIALPLLLFQTPKSASSSSRPSVLSLLGGTNAEQAPQVDYTQHVFL
PFFRKHFLPPSATNATTTTTNDVNSRIKLEIKKRGYYPKGGGEINLCVWPLLPGQKFRAVNLVERSRLVTIHGLA
HCAGLPRIVGEGMSQGAVKRIQEWGNKNGLSIADNGVAPAAVAAATAGGETKNPVLMDINVKREPNGSTKGAGSG
IVLWAEFENGVVMGGSAVGKKGLDPSQVGKSAAEELIKGIEAGGCVDEWTQDQIIIFMALAEGKSQVRCGTKDLT
LHTRTAIWVAEQLTEAKFEVKQEDSGHWTIHCEGTGFSMSG*
Coding >Agabi119p4|059510
ATGTCTCCTCACCTACAGATAATCAACGGGAGTATCCTCGAAGGAGGAGGACAAATTCTTCGTAATTCTGTCTCG
CTGTCAGCTCTCCTACAAAAGCCTATCCGAATTGAAAATATTCGAGCTGGTAGATCACAGCCGGGTCTAAAAAAT
CAACACCGCACCGGTCTAGACCTTGTTGCCCGCATAGCATCAGCTCAATTAACAGGTGCCACTAATGGGTCAACC
AACGTGGAATTTAAACCAGGGAGAATTGAGCTTCCAGGATCATGGAAGGCAGATACGGTCACCGCAGGTGCCACA
ACGCTGCTTATACAAATTGCCTTGCCATTATTGCTTTTCCAAACTCCAAAATCAGCATCATCATCGTCAAGACCG
AGTGTGTTGAGTTTACTAGGGGGGACTAATGCTGAACAAGCACCTCAAGTGGATTATACCCAACATGTCTTTTTG
CCGTTCTTCCGGAAACATTTCTTACCCCCGTCGGCGACAAATGCTACTACTACTACTACCAACGACGTCAATTCG
AGAATCAAACTTGAAATTAAAAAGAGAGGGTATTATCCGAAAGGTGGAGGAGAAATCAATTTATGCGTGTGGCCA
CTTTTACCAGGACAGAAATTTCGTGCTGTGAATTTGGTAGAGAGGAGTCGATTGGTGACTATCCATGGATTGGCA
CACTGCGCAGGGTTACCCAGAATCGTAGGAGAAGGGATGAGTCAGGGGGCTGTGAAGAGAATTCAAGAATGGGGT
AACAAAAATGGATTATCGATCGCAGACAATGGTGTTGCTCCTGCTGCTGTTGCTGCTGCTACTGCGGGAGGTGAA
ACAAAAAACCCGGTGTTGATGGATATTAACGTGAAACGAGAACCGAATGGTTCGACGAAAGGAGCAGGGAGTGGA
ATTGTCTTATGGGCAGAATTTGAAAATGGAGTGGTGATGGGTGGAAGTGCTGTTGGAAAGAAAGGCTTGGACCCG
AGCCAAGTTGGAAAGAGTGCTGCTGAAGAATTAATAAAAGGGATTGAAGCGGGAGGTTGTGTTGACGAGTGGACA
CAGGACCAGATCATCATTTTCATGGCTCTCGCGGAGGGCAAAAGCCAAGTGAGGTGTGGCACAAAAGATCTAACC
CTACATACAAGGACCGCGATCTGGGTCGCTGAGCAACTAACAGAGGCCAAATTTGAGGTGAAACAAGAGGATAGC
GGTCACTGGACGATTCATTGCGAGGGGACAGGGTTTTCGATGAGTGGGTAG
Transcript >Agabi119p4|059510
ATGTCTCCTCACCTACAGATAATCAACGGGAGTATCCTCGAAGGAGGAGGACAAATTCTTCGTAATTCTGTCTCG
CTGTCAGCTCTCCTACAAAAGCCTATCCGAATTGAAAATATTCGAGCTGGTAGATCACAGCCGGGTCTAAAAAAT
CAACACCGCACCGGTCTAGACCTTGTTGCCCGCATAGCATCAGCTCAATTAACAGGTGCCACTAATGGGTCAACC
AACGTGGAATTTAAACCAGGGAGAATTGAGCTTCCAGGATCATGGAAGGCAGATACGGTCACCGCAGGTGCCACA
ACGCTGCTTATACAAATTGCCTTGCCATTATTGCTTTTCCAAACTCCAAAATCAGCATCATCATCGTCAAGACCG
AGTGTGTTGAGTTTACTAGGGGGGACTAATGCTGAACAAGCACCTCAAGTGGATTATACCCAACATGTCTTTTTG
CCGTTCTTCCGGAAACATTTCTTACCCCCGTCGGCGACAAATGCTACTACTACTACTACCAACGACGTCAATTCG
AGAATCAAACTTGAAATTAAAAAGAGAGGGTATTATCCGAAAGGTGGAGGAGAAATCAATTTATGCGTGTGGCCA
CTTTTACCAGGACAGAAATTTCGTGCTGTGAATTTGGTAGAGAGGAGTCGATTGGTGACTATCCATGGATTGGCA
CACTGCGCAGGGTTACCCAGAATCGTAGGAGAAGGGATGAGTCAGGGGGCTGTGAAGAGAATTCAAGAATGGGGT
AACAAAAATGGATTATCGATCGCAGACAATGGTGTTGCTCCTGCTGCTGTTGCTGCTGCTACTGCGGGAGGTGAA
ACAAAAAACCCGGTGTTGATGGATATTAACGTGAAACGAGAACCGAATGGTTCGACGAAAGGAGCAGGGAGTGGA
ATTGTCTTATGGGCAGAATTTGAAAATGGAGTGGTGATGGGTGGAAGTGCTGTTGGAAAGAAAGGCTTGGACCCG
AGCCAAGTTGGAAAGAGTGCTGCTGAAGAATTAATAAAAGGGATTGAAGCGGGAGGTTGTGTTGACGAGTGGACA
CAGGACCAGATCATCATTTTCATGGCTCTCGCGGAGGGCAAAAGCCAAGTGAGGTGTGGCACAAAAGATCTAACC
CTACATACAAGGACCGCGATCTGGGTCGCTGAGCAACTAACAGAGGCCAAATTTGAGGTGAAACAAGAGGATAGC
GGTCACTGGACGATTCATTGCGAGGGGACAGGGTTTTCGATGAGTGGGTAG
Gene >Agabi119p4|059510
ATGTCTCCTCACCTACAGATAATCAACGGGAGTATCCTCGAAGGAGGAGGACAAATTCTTCGTAATTCTGTCTCG
CTGTCAGCTCTCCTACAAAAGCCTATCCGAATTGAAAATATTCGAGCTGGTAGATCACAGCCGGGTCTAAAAAAT
CAACACCGCACCGGTGAGTGACGCCCTTCACATGTTGATTGAAAATAACCAACAAAGTAGTGGGTTATTCTCATA
TTATTTCATTGCAGGTCTAGACCTTGTTGCCCGCATAGCATCAGCTCAATTAACAGGTGCCACTAATGGGTCAAC
CAACGTGGAATTTAAACCAGGGAGAATTGAGCTTCCAGGATCATGGAAGGCAGATACGGTCACCGCAGGTGCCAC
AACGCTGCTTATACAAATTGCCTTGCCATTATTGCTTTTCCAAACTCCAAAATCAGCATCATCATCGTCAAGACC
GAGTGTGTTGAGTTTACTAGGGGGGACTAATGCTGAACAAGCACCTCAAGTGGATTATACCCAACATGTCTTTTT
GCCGTTCTTCCGGAAACATTTCTTACCCCCGTCGGCGACAAATGCTACTACTACTACTACCAACGACGTCAATTC
GAGAATCAAACTTGAAATTAAAAAGAGAGGGTATTATCCGAAAGGTGGAGGAGAAATCAATTTATGCGTGTGGCC
ACTTTTACCAGGACAGAAATTTCGTGCTGTGAATTTGGTAGAGAGGAGTCGATTGGTGACTATCCATGGATTGGC
ACACTGCGCAGGGTTACCCAGAATCGTAGGAGAAGGGATGAGTCAGGGGGCTGTGAAGAGAATTCAAGAATGGGG
TAACAAAAATGGATTATCGATCGCAGACAATGGTGTTGCTCCTGCTGCTGTTGCTGCTGCTACTGCGGGAGGTGA
AACAAAAAACCCGGTGTTGATGGATATTAACGTGAAACGAGAACCGAATGGTTCGACGAAAGGAGCAGGGAGTGG
AATTGTCTTATGGGCAGAATTTGAAAATGGAGTGGTGATGGGTGGAAGTGCTGTTGGAAAGAAAGGCTTGGACCC
GAGCCAAGTTGGAAAGAGTGCTGCTGAAGAATTAATAAAAGGGATTGAAGCGGGAGGTTGTGTTGACGAGGTGAA
TTTAAATGAAGCTTCGGATGAGCACGAACTAATCTCTCGACACAGTGGACACAGGACCAGATCATCATTTTCATG
GCTCTCGCGGAGGGCAAAAGCCAAGTGAGGTGTGGCACAAAAGATCTAACCCTACATACAAGGTCGGTTTGAGCA
GCATAGTATTTTTGGACATTATTAATGATAGCAATATTTCATCAGGACCGCGATCTGGGTCGCTGAGCAACTAAC
AGAGGCCAAATTTGAGGTGAAACAAGAGGATAGCGGTCACTGGACGATTCATTGCGAGGGGACAGGGTTTTCGAT
GAGTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail