Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|059190
Gene name
Locationscaffold_03a:1618778..1619639
Strand+
Gene length (bp)861
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00335 Tetraspanin Tetraspanin family 8.2E-10 6 194

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 41 63 22
3 76 98 22
4 174 196 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|059190
MGVWAALNFLLLVAGAVTLALSIVWRGPNLLMNMVLSDADLTAGIILAIAFIITCITGIVGVIQRNHITIGLVIT
NYALLVDAIGIVIIGTFVWFFTLKERHNYSVLWDAATPDVRRALQDQLKCCGYFNNTDFAEISTFCKDQQFISSL
NQTDLNNSCVTPITDFADMTLNNIFTTVYGYMAIVLCLLLATLCVIKKRHEDERFNKIDAKRGGKGFV*
Coding >Agabi119p4|059190
ATGGGCGTCTGGGCTGCCCTGAACTTTTTGTTGCTTGTTGCAGGCGCAGTCACTCTCGCGCTCTCGATTGTATGG
CGTGGACCTAATCTCCTCATGAATATGGTCTTATCTGATGCGGACCTTACTGCTGGTATCATACTGGCGATCGCC
TTCATCATAACCTGTATCACAGGCATTGTTGGTGTCATACAGCGAAACCACATCACTATCGGCCTTGTCATCACT
AACTACGCGCTCCTGGTGGATGCTATTGGCATTGTTATTATTGGGACTTTTGTCTGGTTTTTCACTCTGAAGGAA
CGGCACAATTATTCGGTATTGTGGGATGCGGCCACTCCAGACGTTCGTCGGGCCCTTCAGGATCAGCTGAAGTGT
TGCGGATACTTCAATAACACCGACTTCGCAGAAATCAGTACTTTTTGCAAGGATCAGCAATTCATCAGCAGCCTT
AATCAAACCGATTTGAACAATTCTTGTGTCACTCCGATTACTGATTTCGCTGACATGACTCTGAACAATATTTTT
ACAACCGTTTATGGCTACATGGCAATCGTTCTTTGCCTTTTGCTCGCCACCCTATGCGTGATCAAGAAGAGGCAT
GAAGATGAGCGATTCAACAAAATTGACGCGAAGCGGGGAGGCAAAGGTTTTGTGTAA
Transcript >Agabi119p4|059190
ATGGGCGTCTGGGCTGCCCTGAACTTTTTGTTGCTTGTTGCAGGCGCAGTCACTCTCGCGCTCTCGATTGTATGG
CGTGGACCTAATCTCCTCATGAATATGGTCTTATCTGATGCGGACCTTACTGCTGGTATCATACTGGCGATCGCC
TTCATCATAACCTGTATCACAGGCATTGTTGGTGTCATACAGCGAAACCACATCACTATCGGCCTTGTCATCACT
AACTACGCGCTCCTGGTGGATGCTATTGGCATTGTTATTATTGGGACTTTTGTCTGGTTTTTCACTCTGAAGGAA
CGGCACAATTATTCGGTATTGTGGGATGCGGCCACTCCAGACGTTCGTCGGGCCCTTCAGGATCAGCTGAAGTGT
TGCGGATACTTCAATAACACCGACTTCGCAGAAATCAGTACTTTTTGCAAGGATCAGCAATTCATCAGCAGCCTT
AATCAAACCGATTTGAACAATTCTTGTGTCACTCCGATTACTGATTTCGCTGACATGACTCTGAACAATATTTTT
ACAACCGTTTATGGCTACATGGCAATCGTTCTTTGCCTTTTGCTCGCCACCCTATGCGTGATCAAGAAGAGGCAT
GAAGATGAGCGATTCAACAAAATTGACGCGAAGCGGGGAGGCAAAGGTTTTGTGTAA
Gene >Agabi119p4|059190
ATGGGCGTCTGGGCTGCCCTGAACTTTTTGTTGCTTGTTGCAGGCGCAGTCACTCTCGCGCTCTCGATTGTATGG
CGTGGACCTAATCTCCTCATGAATATGGTCTTATCTGATGCGGACCTTACTGGTAAGCCCTCCGTCTGTGTTTCC
CTTCGGTCTCTGTTCTGAAAATCTACAGCTGGTATCATACTGGCGATCGCCTTCATCATAACCTGTATCACAGGC
ATTGTTGGTGTCATACAGCGAAACCACATCACTATCGGCCTTGTCATCACTAACTACGCGCTCCTGGTGGATGCT
ATTGGCATTGTTATTATTGGGACTTTTGTCTGGTTTTTCACTCTGAAGGAACGGCACAATTATTCGGTATTGTGG
GATGCGGCCACTCCAGACGTTCGTCGGGCCCTTCAGGATCAGGTATGCTTCGCTGTCACTTCAATGAAGTCACCA
CTTAGTGTTATGTAGCTGAAGTGTTGCGGATACTTCAATAACACCGACTTCGCAGAAATCAGTACTTTTTGCAAG
GATCAGCAATTCATCAGCAGCCTTAATCAAACCGATTTGAACAATTCTTGTGTCACTCCGATTACTGATTTCGCT
GACATGACTCTGAACAATATTTTTACGTGCGCATGCTCAAAACTCAATTTTGACCTTAATGATTCACGTCTCGTA
GAACCGTTTATGGCTACATGGCAATCGTTCTTTGCCTTTTGCTCGCCACCCTATGCGTGATCAAGAAGGCAAGTA
CAATCTAATGAGGTTCTTGTACTCAGTCAAACCTTATGATGATAACAGAGGCATGAAGATGAGCGATTCAACAAA
ATTGACGCGAAGCGGGGAGGCAAAGGTTTTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail